DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14414 and Syp

DIOPT Version :9

Sequence 1:NP_001285240.1 Gene:CG14414 / 32394 FlyBaseID:FBgn0030571 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster


Alignment Length:119 Identity:37/119 - (31%)
Similarity:51/119 - (42%) Gaps:24/119 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GGNPEEARRIWVGNLDSRITDSIC-IAP---YRFQLLKLMQKCGAIEKFDMLFHKGGPMVGQSRG 80
            ||.|..    |.||:.....:..| ..|   |..:|:.|.:.||.|....::.   .||.|.:||
  Fly   191 GGPPPH----WEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMM---DPMTGTNRG 248

  Fly    81 YAFVTFAQNEGATNALLKLD------GTSVG-------NRSIAVRLAKNIKYDE 121
            ||||||...|.|.||:.:|:      |..:|       :|.....:.||...||
  Fly   249 YAFVTFTNREAAVNAVRQLNDFEIRTGKKIGVTISFNNHRLFVGNIPKNRDRDE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14414NP_001285240.1 RRM <22..>126 CDD:223796 35/117 (30%)
RRM_RBM18 28..115 CDD:240801 30/103 (29%)
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695 26/80 (33%)
RRM2_hnRNPR_like 286..367 CDD:240696 5/17 (29%)
RRM3_hnRNPR_like 381..452 CDD:240697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21245
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.