DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12540 and ama-1

DIOPT Version :10

Sequence 1:NP_572963.1 Gene:CG12540 / 32393 FlyBaseID:FBgn0030570 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_500523.4 Gene:ama-1 / 177190 WormBaseID:WBGene00000123 Length:1856 Species:Caenorhabditis elegans


Alignment Length:67 Identity:24/67 - (35%)
Similarity:36/67 - (53%) Gaps:12/67 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 STRQFGGGQN-FGNGLGPSFGGVG----AGGLGPGAGFGP-----GSAAGYPGQGGYGPAQQPGC 83
            |.|:|....: :.:|:.|::.|..    .||:.|||||.|     |.|:.: .:||:.|| .||.
 Worm  1497 SNREFSPAHSPWNSGVTPTYAGAAWSPTTGGMSPGAGFSPAGNTDGGASPF-NEGGWSPA-SPGD 1559

  Fly    84 PL 85
            ||
 Worm  1560 PL 1561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12540NP_572963.1 None
ama-1NP_500523.4 RNAP_II_RPB1_N 17..870 CDD:259848
RNA_pol_Rpb1_6 890..1073 CDD:461511
RNAP_II_Rpb1_C 1053..1468 CDD:132720
CTD 1493..1584 CDD:215026 24/67 (36%)
Herpes_BLLF1 <1687..>1837 CDD:282904
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.