DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and CD86

DIOPT Version :10

Sequence 1:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_787058.5 Gene:CD86 / 942 HGNCID:1705 Length:329 Species:Homo sapiens


Alignment Length:361 Identity:81/361 - (22%)
Similarity:137/361 - (37%) Gaps:97/361 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CTDGASKRFFT-DFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVS-----W 76
            ||.|.|...|. .||.....|            ..|.....:|..|.|:..|..|:::|     |
Human     5 CTMGLSNILFVMAFLLSGAAP------------LKIQAYFNETADLPCQFANSQNQSLSELVVFW 57

  Fly    77 VRHRDIHLLTVGRYTYTSDQRFEAMHSPH-------AEDWTLRIRYAQRKDSGIYECQISTTPPI 134
            ....::.|..|    |...::|:::||.:       ::.||||:...|.||.|:|:|.|....|.
Human    58 QDQENLVLNEV----YLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPT 118

  Fly   135 G----H------SVYLNIVEPVTDIIGGPELHINRGSTINLTC-IVKFAPEPPP-TVIWSHNREI 187
            |    |      ||..|..:|  :|:  |..:|.....||||| .:...|||.. :|:.......
Human   119 GMIRIHQMNSELSVLANFSQP--EIV--PISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNST 179

  Fly   188 INFDSPRGGI-----SLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSN-----ANPTSVRVHIVD 242
            |.:|    |:     ..|||...::.|..:....:|.:..::....::     ::|.|:.:    
Human   180 IEYD----GVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIEL---- 236

  Fly   243 GEHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLVASCSTLVPATPPGCRTVQQASTFAE 307
             |.|             ..||..:|.:.....|:::..:| .|..|                :..
Human   237 -EDP-------------QPPPDHIPWITAVLPTVIICVMV-FCLIL----------------WKW 270

  Fly   308 EKAMGQRSNRNC-QDLQELEESQDLRRRGVERSAVP 342
            :|....|::..| .:..|.|||:..::|  |:..:|
Human   271 KKKKRPRNSYKCGTNTMEREESEQTKKR--EKIHIP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_727781.1 IG_like 51..131 CDD:214653 25/91 (27%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 1/8 (13%)
Ig strand E 109..113 CDD:409353 3/3 (100%)
Ig strand F 123..128 CDD:409353 2/4 (50%)
Ig_3 153..230 CDD:464046 19/83 (23%)
CD86NP_787058.5 IgV_CD86 26..133 CDD:409508 29/110 (26%)
FR1 26..40 CDD:409508 3/13 (23%)
Ig strand A 26..31 CDD:409508 1/4 (25%)
Ig strand B 34..40 CDD:409508 2/5 (40%)
CDR1 41..52 CDD:409508 2/10 (20%)
FR2 53..60 CDD:409508 1/6 (17%)
Ig strand C 53..59 CDD:409508 1/5 (20%)
CDR2 62..82 CDD:409508 6/23 (26%)
Ig strand C' 64..69 CDD:409508 2/8 (25%)
Ig strand C' 72..74 CDD:409508 0/1 (0%)
FR3 83..115 CDD:409508 11/31 (35%)
Ig strand D 85..89 CDD:409508 0/3 (0%)
Ig strand E 93..99 CDD:409508 4/5 (80%)
Ig strand F 106..114 CDD:409508 4/7 (57%)
CDR3 116..118 CDD:409508 0/1 (0%)
FR4 119..133 CDD:409508 3/13 (23%)
Ig strand G 120..133 CDD:409508 2/12 (17%)
Ig 136..221 CDD:472250 21/92 (23%)
Ig strand B 152..157 CDD:409505 3/4 (75%)
Ig strand C 167..172 CDD:409505 0/4 (0%)
Ig strand E 201..205 CDD:409505 1/3 (33%)
Ig strand F 215..220 CDD:409505 0/4 (0%)

Return to query results.
Submit another query.