DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and PAPLN

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:311 Identity:70/311 - (22%)
Similarity:97/311 - (31%) Gaps:95/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DFLQDLPTPGTGGP---------------TFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVR 78
            |..||....|..||               ..|......:....|:.:::|||.:......:.|.|
Human  1015 DPAQDFGQAGAAGPLGAIPSSHPQPANRLRLDQNQPRVVDASPGQRIRMTCRAEGFPPPAIEWQR 1079

  Fly    79 HRDIHLLTVGRYTYTSDQRFEAMHSPHAE---DWTLRIRYAQRKDSGIYECQISTTPPIGHS--- 137
            ..                  :.:.||..:   |.:|.|.....:|.|.|.|....    |..   
Human  1080 DG------------------QPVSSPRHQLQPDGSLVISRVAVEDGGFYTCVAFN----GQDRDQ 1122

  Fly   138 --VYLNIVEPVTDIIGG--PELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFD------S 192
              |.|.::..:|  |.|  |.:.:..|.|..|.|:|  |.| ...:.||.|...:..|      |
Human  1123 RWVQLRVLGELT--ISGLPPTVTVPEGDTARLLCVV--AGE-SVNIRWSRNGLPVQADGHRVHQS 1182

  Fly   193 PRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTP---SNANPTSVRVHIVDGEHPA-AMHTGN 253
            |.|              .||:.....:|.|.|||:.   |.|...|..|.:|.   || .....:
Human  1183 PDG--------------TLLIYNLRARDEGSYTCSAYQGSQAVSRSTEVKVVS---PAPTAQPRD 1230

  Fly   254 NGNSTASQPPVLLPLVLLTCSTLMLLQL----------VASCSTLVPATPP 294
            .|.....||.      |..|..::..||          .||||...|...|
Human  1231 PGRDCVDQPE------LANCDLILQAQLCGNEYYSSFCCASCSRFQPHAQP 1275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 15/82 (18%)
V-set 52..143 CDD:284989 18/98 (18%)
IG_like 153..238 CDD:214653 25/93 (27%)
ig 153..232 CDD:278476 23/87 (26%)
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767
Ig 914..>978 CDD:325142
I-set 1049..1119 CDD:254352 16/91 (18%)
IG 1139..1219 CDD:214652 26/96 (27%)
PLAC 1235..1267 CDD:312271 8/37 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.