DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and dpr21

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:247 Identity:135/247 - (54%)
Similarity:182/247 - (73%) Gaps:14/247 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPH 105
            ||.|||:...|:|.|||.|..|.||:|||||:||||:||||:|||||...||||||||.::::..
  Fly    50 GPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQ 114

  Fly   106 AEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVK 170
            ..||:|:|::.|.:||||||||:|||||:|:::..::|||:|.|:||||::|:.|||:||||::|
  Fly   115 TGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIK 179

  Fly   171 FAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTS 235
            ..|:||.:|.|:||.:.||:||||||:|::||||.:|||.||:|:|...|||.|||.|||||..|
  Fly   180 HLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKS 244

  Fly   236 VRVHIVDGEHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLVASCST 287
            |.|||:.|:||||:           |...||...||   :|..||:..:.||
  Fly   245 VNVHILKGDHPAAV-----------QKSHLLVSELL---SLCFLQICLNLST 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 49/79 (62%)
V-set 52..143 CDD:284989 53/90 (59%)
IG_like 153..238 CDD:214653 51/84 (61%)
ig 153..232 CDD:278476 47/78 (60%)
dpr21NP_001163838.2 Ig 71..149 CDD:299845 48/77 (62%)
IG_like 71..140 CDD:214653 43/68 (63%)
IG_like 162..249 CDD:214653 52/86 (60%)
IGc2 169..242 CDD:197706 45/72 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.