DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and KIRREL2

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_954649.3 Gene:KIRREL2 / 84063 HGNCID:18816 Length:708 Species:Homo sapiens


Alignment Length:236 Identity:58/236 - (24%)
Similarity:88/236 - (37%) Gaps:41/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LVGKTVKLTCRVKNLGN--RTVSWVR-------HRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWT 110
            |:|:..:|.|.   ||.  ..|.|.:       .||  |....|| :.|.......|..|     
Human    36 LLGEEARLPCA---LGAYWGLVQWTKSGLALGGQRD--LPGWSRY-WISGNAANGQHDLH----- 89

  Fly   111 LRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEP--VTDIIGGPELHINRGSTINLTCIVKFAP 173
              ||..:.:|...||||.:..........|:::.|  ...::|||.:.:..|...||||..:...
Human    90 --IRPVELEDEASYECQATQAGLRSRPAQLHV
LVPPEAPQVLGGPSVSLVAGVPANLTCRSRGDA 152

  Fly   174 EPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSG-LYTC-TPSNANPTSV 236
            .|.|.::|.  |:.:..|......:|:.|....:....|.....:.|.| .:.| ..|.|.||..
Human   153 RPTPELLWF--RDGVLLDGATFHQTLLKEGTPGSVESTLTLTPFSHDDGATFVCRARSQALPTGR 215

  Fly   237 RVHI-VDGEHP------AAMHTGNNGN------STASQPPV 264
            ...| :..::|      |:.||...|.      ...:||||
Human   216 DTAITLSLQYPPEVTLSASPHTVQEGEKVIFLCQATAQPPV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 23/84 (27%)
V-set 52..143 CDD:284989 24/96 (25%)
IG_like 153..238 CDD:214653 21/86 (24%)
ig 153..232 CDD:278476 18/80 (23%)
KIRREL2NP_954649.3 IG_like 30..119 CDD:214653 24/95 (25%)
IGc2 38..106 CDD:197706 22/80 (28%)
I-set 126..224 CDD:254352 24/99 (24%)
Ig2_KIRREL3-like 141..223 CDD:143236 20/83 (24%)
Cell attachment site. /evidence=ECO:0000255 149..151 0/1 (0%)
Ig 231..306 CDD:299845 8/26 (31%)
IG_like 234..308 CDD:214653 7/23 (30%)
Ig 312..395 CDD:299845
I-set 317..395 CDD:254352
Ig 397..501 CDD:299845
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..601
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.