DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and CG34353

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:229 Identity:65/229 - (28%)
Similarity:99/229 - (43%) Gaps:39/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRK 119
            :.|:|:.|.|.|.|.....|:|  .|.|.:||.|....|.|.|...::.     :.|:||.|...
  Fly    98 ITGETIVLPCEVANTDTYVVAW--KRGIAILTAGSVKVTPDPRVRLVNG-----FNLQIRDALPT 155

  Fly   120 DSGIYECQISTTPP--IGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWS 182
            |:|.|.|||:|..|  |.|:|.:.:...:..|..|..|.:.:||::.:.|  .....|.|.|.||
  Fly   156 DAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIEC--SATGNPMPNVTWS 218

  Fly   183 HNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSN--ANPTSVRV--HI--- 240
            ....|:    |.|     .||  |.:..|.::.......|:|.||.:|  ..|.|.:|  |:   
  Fly   219 RKNNIL----PNG-----EEK--LHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFS 272

  Fly   241 --VDGEHPAAMHTGNNGNST-------ASQPPVL 265
              :..|.| .:.:|....:|       .:||.|:
  Fly   273 PEISVERP-VVFSGEGHEATLVCIVHGETQPEVI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 26/75 (35%)
V-set 52..143 CDD:284989 31/89 (35%)
IG_like 153..238 CDD:214653 23/86 (27%)
ig 153..232 CDD:278476 21/80 (26%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 31/86 (36%)
Ig 103..177 CDD:143165 28/80 (35%)
IG_like 191..269 CDD:214653 24/90 (27%)
IGc2 198..258 CDD:197706 20/72 (28%)
I-set 273..360 CDD:254352 7/34 (21%)
Ig 290..359 CDD:143165 4/16 (25%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.