DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and dscama

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_021334866.1 Gene:dscama / 568643 ZFINID:ZDB-GENE-050310-7 Length:2025 Species:Danio rerio


Alignment Length:208 Identity:47/208 - (22%)
Similarity:86/208 - (41%) Gaps:48/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYA 116
            :.|.||..|.|:|.|.......:||.|:.|       :....::.|...::..:     |.:...
Zfish   324 VKGSVGSQVSLSCSVTGSDEFELSWYRNGD-------KINTGANIRMNGINKEN-----LVMDGM 376

  Fly   117 QRKDSGIYEC-------------QI---STTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINL 165
            .:.|.|:|:|             |:   ..||        .|:...::.:.||      ...::|
Zfish   377 AKSDGGVYQCFSRKAKMSAQDFVQVI
LEDGTP--------KILSAFSEKVVGP------NDFVSL 427

  Fly   166 TCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSN 230
            ||.||..|:  |.:.|:.:.|::..||....:..:|.:|.: .|.|.:.....:|||:|.||.:|
Zfish   428 TCHVKGTPQ--PAITWTLDDEVVAKDSRHRIVHSITAEGNV-VSYLNISHIQVRDSGVYRCTCNN 489

  Fly   231 ANPT---SVRVHI 240
            :..|   ..|:::
Zfish   490 SAGTVSYQARINV 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 18/94 (19%)
V-set 52..143 CDD:284989 20/106 (19%)
IG_like 153..238 CDD:214653 24/87 (28%)
ig 153..232 CDD:278476 23/78 (29%)
dscamaXP_021334866.1 Ig 124..217 CDD:325142
I-set 236..311 CDD:254352
IG_like 321..402 CDD:214653 18/89 (20%)
I-set 408..502 CDD:333254 28/110 (25%)
IGc2 524..579 CDD:197706
Ig 614..679 CDD:319273
Ig_DSCAM 708..787 CDD:143211
Ig 805..898 CDD:325142
FN3 894..988 CDD:238020
FN3 995..1092 CDD:238020
fn3 1100..1186 CDD:306538
fn3 1199..1282 CDD:306538
Ig 1312..1377 CDD:319273
fn3 1405..1471 CDD:306538
FN3 1492..1563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.