DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and igsf9ba

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba / 567389 ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio


Alignment Length:260 Identity:58/260 - (22%)
Similarity:101/260 - (38%) Gaps:52/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHA 106
            |||..|....:....|.::.|||.........|:|:|..| .|.:..:||              .
Zfish   139 PTFSDTPPQYVEAREGGSITLTCTAFGNPKPVVTWLREGD-QLTSTRKYT--------------V 188

  Fly   107 EDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLN--IVEPVTDIIGGPE-LHINRGSTINLTCI 168
            .|.:|.::...|:|.|.|.|:..:..  |.:::..  :|:....|:..|| :.:|.......||.
Zfish   189 SDGSLTVQAITREDRGAYSCRAHSDQ--GEALHTTRLLVQGPPYIVTPPENITVNISQNAQFTCQ 251

  Fly   169 VKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNA-- 231
            .:..| ...|..|....:.:.|.:     .|.....:.....|::.:...:|:|.|||:|||:  
Zfish   252 AEAYP-GNLTYTWYWEEDNVYFKN-----DLKLRVRIFIDGTLIIYRVKPEDAGKYTCSPSNSLG 310

  Fly   232 -NPTSVRVHIVDGEHPAAMHTGNNGNSTASQPPVL-LPLVLLTCSTLMLLQLVASCSTLVPATPP 294
             :|::.....|  ::||.:         .:.|||: :|         ..|..:..|.  |.|.||
Zfish   311 ISPSASAYLTV--QYPARV---------VNMPPVIYVP---------RKLSGIIRCP--VDANPP 353

  Fly   295  294
            Zfish   354  353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 18/79 (23%)
V-set 52..143 CDD:284989 19/92 (21%)
IG_like 153..238 CDD:214653 20/88 (23%)
ig 153..232 CDD:278476 19/82 (23%)
igsf9baXP_009289969.2 IG 30..115 CDD:214652
I-set 139..225 CDD:254352 23/102 (23%)
I-set 229..321 CDD:333254 21/97 (22%)
Ig 345..415 CDD:325142 5/11 (45%)
Ig 438..503 CDD:319273
FN3 511..606 CDD:238020
FN3 622..706 CDD:238020
Atrophin-1 <924..1361 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.