DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and robo4

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:196 Identity:45/196 - (22%)
Similarity:71/196 - (36%) Gaps:63/196 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LRIRYAQRKDSGIYECQISTTPPIGHS--VYLNIV-EPVTDIIGGPE-LHINRGSTINLTCIVKF 171
            |.|..||:.|||:|.|..|....:..|  ..|::: :||  ::..|| :.:..|.:....|  :.
Zfish   228 LIIAPAQKNDSGVYSCIASNMIGVRESRAARLSV
LAKPV--LLRKPEDVSVQLGESAQFFC--EA 288

  Fly   172 APEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQK--------AITQDSGLYTCTP 228
            ..:|.|::.||.                  |:|.|...|.|:..        ...||.|.|:||.
Zfish   289 DGDPMPSIEWSR------------------EQGPLPNGRYLINPDHSLQIHYVTAQDMGRYSCTV 335

  Fly   229 SN---ANPTSVRVHIVDG-------------------EHPAAMHTGNNGN-------STASQPPV 264
            .|   .:..|.::.:.|.                   |:...|.|.:|.:       |..|||..
Zfish   336 ENKLGVSVASAQLLVEDAGGTRLRDLHKELSALRVSLENVTVMSTASNMSQVMWKLQSFGSQPHY 400

  Fly   265 L 265
            |
Zfish   401 L 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 10/19 (53%)
V-set 52..143 CDD:284989 12/33 (36%)
IG_like 153..238 CDD:214653 21/96 (22%)
ig 153..232 CDD:278476 20/90 (22%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317
I-set 71..168 CDD:254352
I-set 175..261 CDD:254352 12/32 (38%)
Ig2_Robo 177..261 CDD:143201 12/32 (38%)
I-set 265..350 CDD:254352 23/106 (22%)
Ig 282..350 CDD:299845 18/87 (21%)
FN3 373..448 CDD:214495 9/29 (31%)
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.