DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and iglon5

DIOPT Version :10

Sequence 1:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:242 Identity:53/242 - (21%)
Similarity:99/242 - (40%) Gaps:58/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NITGLVGKTVKLTCRV-KNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIR 114
            |||.|.|::|.|.|:: :.:.::  :|:...:|  |..|...::.|.|. ::.:.:..|:::||.
Zfish    35 NITVLEGESVVLRCKIDEEVTHK--AWLNRSNI--LFTGTDKWSLDSRV-SLENNNNSDFSIRIE 94

  Fly   115 YAQRKDSGIYEC--QISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPP 177
            .....|.|.|.|  |....|...| |||.:..|...:....:..:|.|..:||.|:....||  |
Zfish    95 RVMVADEGPYTCSFQARNKPRTAH-VYLIVQVPARIVNISQDKSVNEGEDVNLFCLAVGRPE--P 156

  Fly   178 TVIWSHNR-EIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSN--ANPTSVRVH 239
            |:.|...: .::|    .|....:||          :::...:|   :.|..:|  |.|.:.:|.
Zfish   157 TITWKDFKYGLLN----EGEFLEITE----------IKRHQAED---FECITNNGVAPPDTRKVK 204

  Fly   240 IVDGEHPAAMHTGNNGNSTASQPPVLLPL----------VLLTCSTL 276
            :                 |.:.||::..:          .:|.|..:
Zfish   205 V-----------------TVNYPPIITDVKNMPAQVGKTAILRCEAM 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_727781.1 IG_like 51..131 CDD:214653 22/82 (27%)
Ig strand B 60..64 CDD:409353 2/3 (67%)
Ig strand C 73..77 CDD:409353 0/3 (0%)
Ig strand E 109..113 CDD:409353 0/3 (0%)
Ig strand F 123..128 CDD:409353 2/6 (33%)
Ig_3 153..230 CDD:464046 16/77 (21%)
iglon5NP_001017775.2 Ig 35..123 CDD:472250 27/93 (29%)
Ig strand B 44..48 CDD:409353 2/3 (67%)
Ig strand C 56..60 CDD:409353 0/5 (0%)
Ig strand E 89..93 CDD:409353 0/3 (0%)
Ig strand F 103..108 CDD:409353 2/4 (50%)
Ig strand G 116..119 CDD:409353 1/3 (33%)
Ig 122..207 CDD:472250 21/120 (18%)
Ig strand B 144..148 CDD:409353 2/3 (67%)
Ig strand C 157..161 CDD:409353 1/3 (33%)
Ig strand E 172..176 CDD:409353 0/3 (0%)
Ig strand F 186..191 CDD:409353 2/7 (29%)
Ig strand G 200..203 CDD:409353 0/2 (0%)
Ig_3 210..287 CDD:464046 4/25 (16%)

Return to query results.
Submit another query.