DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and iglon5

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:242 Identity:53/242 - (21%)
Similarity:99/242 - (40%) Gaps:58/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NITGLVGKTVKLTCRV-KNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIR 114
            |||.|.|::|.|.|:: :.:.::  :|:...:|  |..|...::.|.|. ::.:.:..|:::||.
Zfish    35 NITVLEGESVVLRCKIDEEVTHK--AWLNRSNI--LFTGTDKWSLDSRV-SLENNNNSDFSIRIE 94

  Fly   115 YAQRKDSGIYEC--QISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPP 177
            .....|.|.|.|  |....|...| |||.:..|...:....:..:|.|..:||.|:....||  |
Zfish    95 RVMVADEGPYTCSFQARNKPRTAH-VYLIVQVPARIVNISQDKSVNEGEDVNLFCLAVGRPE--P 156

  Fly   178 TVIWSHNR-EIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSN--ANPTSVRVH 239
            |:.|...: .::|    .|....:||          :::...:|   :.|..:|  |.|.:.:|.
Zfish   157 TITWKDFKYGLLN----EGEFLEITE----------IKRHQAED---FECITNNGVAPPDTRKVK 204

  Fly   240 IVDGEHPAAMHTGNNGNSTASQPPVLLPL----------VLLTCSTL 276
            :                 |.:.||::..:          .:|.|..:
Zfish   205 V-----------------TVNYPPIITDVKNMPAQVGKTAILRCEAM 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 22/82 (27%)
V-set 52..143 CDD:284989 26/93 (28%)
IG_like 153..238 CDD:214653 19/87 (22%)
ig 153..232 CDD:278476 17/81 (21%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 27/93 (29%)
Ig 35..123 CDD:299845 27/93 (29%)
Ig 125..>183 CDD:299845 15/73 (21%)
I-set 128..207 CDD:254352 20/114 (18%)
IG_like 217..298 CDD:214653 2/18 (11%)
ig 223..296 CDD:278476 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.