DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and dpr6

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:321 Identity:152/321 - (47%)
Similarity:204/321 - (63%) Gaps:44/321 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIIFLGILCLLAGCTDGASK------RFFTDFLQDLPTPGTGG------------------PTFD 45
            |::.| ::.:::..|:|..:      ....|.|...||||...                  |.||
  Fly    13 WLLLL-VVIVMSDMTNGGVQGPIEGYNSLDDLLTTTPTPGQAALLLPTAPTAAYTHPKWMEPYFD 76

  Fly    46 TTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWT 110
            .:...|:|.|:||:..|:|||:||.|:||||:||||||:||||.|||||||||:|.|....||||
  Fly    77 PSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWT 141

  Fly   111 LRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEP 175
            |:|::||::|:|:|||||||.|...:.|.||:|.|...|:|||:||:::||||||||.|||:|||
  Fly   142 LQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTVKFSPEP 206

  Fly   176 PPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVH- 239
            |..:.|.|:.|:||:||.|||:|::||||.:|||.||:|.|...|||.|:|.||||:..||||| 
  Fly   207 PAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASVRVHV 271

  Fly   240 -----IVDGEHPAAMHTGNNG---NSTASQPPVLLPLVLLTCSTLMLLQLVASCSTLVPAT 292
                 |:.||||.||.||::|   |        .|.:|||.  .|:|......||:.|||:
  Fly   272 LNVRAIISGEHPEAMQTGSSGCQYN--------WLTIVLLL--GLVLCYSSQQCSSAVPAS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 53/79 (67%)
V-set 52..143 CDD:284989 57/90 (63%)
IG_like 153..238 CDD:214653 51/84 (61%)
ig 153..232 CDD:278476 48/78 (62%)
dpr6NP_001287018.1 V-set 79..174 CDD:284989 58/94 (62%)
IG_like 80..175 CDD:214653 58/94 (62%)
IG_like 184..271 CDD:214653 53/86 (62%)
IGc2 191..262 CDD:197706 44/70 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D413759at33208
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
87.970

Return to query results.
Submit another query.