DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and OPCML

DIOPT Version :10

Sequence 1:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:273 Identity:68/273 - (24%)
Similarity:109/273 - (39%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFLGILCLLAGCTDGASKRFFTDFLQDLPTP-GTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLG 70
            :||...||:.     .|.|..  ||.....| .:|..||...: .|:|...|::..|.|.:.:..
Human     7 LFLPWKCLVV-----VSLRLL--FLVPTGVPVRSGDATFPKAM-DNVTVRQGESATLRCTIDDRV 63

  Fly    71 NRTVSWVRHRDIHLLTVGRYTYTSDQR-FEAMHSPHAEDWTLRIRYAQRKDSGIYECQIST-TPP 133
            .| |:|:....|  |..|...::.|.| ...:::|  ..:::.|:.....|.|.|.|.:.| ..|
Human    64 TR-VAWLNRSTI--LYAGNDKWSIDPRVIILVNTP--TQYSIMIQNVDVYDEGPYTCSVQTDNHP 123

  Fly   134 IGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGIS 198
            ....|:|.:..|...:....::.:|.||::.|.|:....||  |||.|.|             :|
Human   124 KTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPE--PTVTWRH-------------LS 173

  Fly   199 LVTEKGVLTTSRLLVQKAITQD-SGLYTCTPSN--ANPTSVRVHIVDGEHPAAMHTGNNGNSTAS 260
            :...:|.::....|....|.:| ||.|.|:..|  |.|...:|.|.....|......|.|.|...
Human   174 VKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQ 238

  Fly   261 QPPVLLPLVLLTC 273
            :.       :|:|
Human   239 KG-------ILSC 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_727781.1 IG_like 51..131 CDD:214653 20/81 (25%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 1/3 (33%)
Ig strand E 109..113 CDD:409353 0/3 (0%)
Ig strand F 123..128 CDD:409353 2/4 (50%)
Ig_3 153..230 CDD:464046 21/77 (27%)
OPCMLNP_001306032.1 Ig 44..132 CDD:472250 23/92 (25%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 2/4 (50%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
Ig_3 135..206 CDD:464046 22/85 (26%)
Ig 224..312 CDD:472250 6/28 (21%)
Ig strand B 240..244 CDD:409353 1/10 (10%)
Ig strand C 253..257 CDD:409353
Ig strand E 279..283 CDD:409353
Ig strand F 293..298 CDD:409353
Ig strand G 306..309 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.