DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and NCAM1

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:361 Identity:82/361 - (22%)
Similarity:130/361 - (36%) Gaps:98/361 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CLLAGCTDGAS-------KRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLG 70
            |::.| .||:.       |.|.....::.|||    ..|..          |:...:.|.|.:..
Human    96 CVVTG-EDGSESEATVNVKIFQKLMFKNAPTP----QEFRE----------GEDAVIVCDVVSSL 145

  Fly    71 NRTVSWVRH--RDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQ------ 127
            ..|:.| :|  ||:.|        ..|.||..:.:.:     |:||..::.|.|.|.|:      
Human   146 PPTIIW-KHKGRDVIL--------KKDVRFIVLSNNY-----LQIRGIKKTDEGTYRCEGRILAR 196

  Fly   128 ----------ISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWS 182
                      |...||        .::...:|:...   .|.|.::.|.|..:..||  ||:.|:
Human   197 GEINFKDIQVIVNVPP--------TIQARQNIVNAT---ANLGQSVTLVCDAEGFPE--PTMSWT 248

  Fly   183 HNREIINFDSPRGGISLVTEKGVLT--TSRLLVQKAITQDSGLYTCTPSN-ANPTSVRVHIVDGE 244
            .:.|.|..:..       .||.:.:  :|:|.::|....|...|.|...| |......:|:....
Human   249 KDGEQIEQEED-------DEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFA 306

  Fly   245 HPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLVASCSTLVPATPPGCRTVQQASTFAEEK 309
            .|...:.   .|.||.:   |...|.|||.        ||...:...|   .|| ...:..:|||
Human   307 KPKITYV---ENQTAME---LEEQVTLTCE--------ASGDPIPSIT---WRT-STRNISSEEK 353

  Fly   310 AMGQRSNRNCQDLQELEESQDLRRRGVERSA-VPGT 344
            |...|..:  |::......|..|::|...|| .||:
Human   354 ASWTRPEK--QEVHAPWNWQVGRQKGQAGSAGFPGS 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 20/97 (21%)
V-set 52..143 CDD:284989 22/108 (20%)
IG_like 153..238 CDD:214653 21/87 (24%)
ig 153..232 CDD:278476 20/81 (25%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 5/19 (26%)
IG 124..190 CDD:214652 22/93 (24%)
Ig 211..307 CDD:325142 25/115 (22%)
Ig 306..438 CDD:325142 27/102 (26%)
Ig_3 447..519 CDD:316449
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.