DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and dpr17

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:261 Identity:84/261 - (32%)
Similarity:134/261 - (51%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMH-SPHAEDWTLRIR 114
            |||..:|....:.|::..|.::.|||||.||.|:::|...|:.:|:||:::: ..|...|:|:|:
  Fly   414 NITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIK 478

  Fly   115 YAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTV 179
            |.:..|:|.||||::|.|.:...|:|.||:|.|::||.....:..||.:.|.|||:...:||..:
  Fly   479 YVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYI 543

  Fly   180 IWSHNREIINFDSPRGGISLVTEKGVL--------TTSRLLVQKAITQDSGLYTCTPSNANPTSV 236
            ||...::.|:....|.|.....::.:.        |...|::.....:|||.|||.|||:...||
  Fly   544 IWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSV 608

  Fly   237 RVHIVDGEHPA------AMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLVASCSTLVPA--TP 293
            .:|::.||:.|      |..|...|.||..             |||.||.::.....:..|  ||
  Fly   609 DLHVLSGEYSASAIMSTAARTTKGGRSTCH-------------STLGLLGILGLLWAMQGAMHTP 660

  Fly   294 P 294
            |
  Fly   661 P 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 30/80 (38%)
V-set 52..143 CDD:284989 33/91 (36%)
IG_like 153..238 CDD:214653 26/92 (28%)
ig 153..232 CDD:278476 24/86 (28%)
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 28/76 (37%)
Ig 415..507 CDD:299845 33/91 (36%)
IG_like 521..612 CDD:214653 26/90 (29%)
IGc2 524..605 CDD:197706 24/80 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.