DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and dpr5

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:256 Identity:107/256 - (41%)
Similarity:154/256 - (60%) Gaps:9/256 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHA 106
            |.||.|....:...:|.|.:|.|||::||:|.|||:|.||:|:||:|..|||:||||.|.|..::
  Fly    90 PVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNS 154

  Fly   107 EDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKF 171
            ::|.|:|...|::|:|:||||:||.|.|..:..|.:|.....|:...||.|..||.||||||...
  Fly   155 DEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQ 219

  Fly   172 APEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSV 236
            ||.|...::|..:.|::: ||.||||.:.:|: .:.||.|::.:....|||.|||:..|:|..||
  Fly   220 APGPYTHMLWHKDTELVS-DSARGGIRVESEQ-QMKTSNLVISRVQHTDSGNYTCSADNSNSDSV 282

  Fly   237 RVHIVDGEHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLVASCSTLVPATPPGCR 297
            .|||:..|..|||.  :...|....||  |||:||   .::|:.|:...|:|...||...|
  Fly   283 FVHIIKSEQHAAMQ--HELGSRLLLPP--LPLLLL---AVLLVVLLGPTSSLQIRTPLSTR 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 39/79 (49%)
V-set 52..143 CDD:284989 43/90 (48%)
IG_like 153..238 CDD:214653 36/84 (43%)
ig 153..232 CDD:278476 33/78 (42%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 44/95 (46%)
IG_like 98..179 CDD:214653 39/80 (49%)
IG_like 206..278 CDD:214653 30/73 (41%)
Ig 211..278 CDD:143165 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.