DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and LSAMP

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:271 Identity:67/271 - (24%)
Similarity:110/271 - (40%) Gaps:66/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IIFLGILCLLAGCTDGASKRFFTDFLQDLPTPGTGGP--TFDTTIGT-NITGLVGKTVKLTCRVK 67
            ::.|.:||||.                      ||.|  :.|...|| |||...|.|..|.|.|:
Human    14 LVLLRLLCLLP----------------------TGLPVRSVDFNRGTDNITVRQGDTAILRCVVE 56

  Fly    68 NLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTT- 131
            : .|..|:|:....|  :..|...::.|.|.| :...|:.:::|||:.....|.|.|.|.:.|. 
Human    57 D-KNSKVAWLNRSGI--IFAGHDKWSLDPRVE-LEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQH 117

  Fly   132 PPIGHSVYLNIVEP--VTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSH----NREIINF 190
            .|....|||.:..|  :::|  ..::.:|.||.:.|.|:....||  |.:.|.|    .||   |
Human   118 EPKTSQVYLIVQVPPKISNI--SSDVTVNEGSNVTLVCMANGRPE--PVITWRHLTPTGRE---F 175

  Fly   191 DSPRGGISLVTEKGVLTTSRLLVQKAITQD-SGLYTCTPSN----ANPTSVRVHIVDGEHPAAMH 250
            :.....:.::               .||:: ||.|.|..:|    |:...|:|.:   .:|..:.
Human   176 EGEEEYLEIL---------------GITREQSGKYECKAANEVSSADVKQVKVTV---NYPPTIT 222

  Fly   251 TGNNGNSTASQ 261
            ...:..:|..:
Human   223 ESKSNEATTGR 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 24/79 (30%)
V-set 52..143 CDD:284989 28/91 (31%)
IG_like 153..238 CDD:214653 22/93 (24%)
ig 153..232 CDD:278476 20/87 (23%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 30/93 (32%)
Ig 132..215 CDD:386229 24/104 (23%)
Ig_3 219..294 CDD:372822 1/15 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.