DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and LSAMP

DIOPT Version :10

Sequence 1:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:53 Identity:16/53 - (30%)
Similarity:24/53 - (45%) Gaps:9/53 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PSPPSYYAEVMATNSSALYPVYVPPYAAPLMSLR--DPRQFQGLPGLAAPPPY 128
            |:...|:.:|:|    .|:|.:.......:.|:|  ||   |.|.||...|.|
Human   211 PALDRYWEQVLA----LLWPRFELILEMNVQSVRSTDP---QRLGGLDTRPHY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_727781.1 IG_like 51..131 CDD:214653 16/53 (30%)
Ig strand B 60..64 CDD:409353
Ig strand C 73..77 CDD:409353
Ig strand E 109..113 CDD:409353 2/5 (40%)
Ig strand F 123..128 CDD:409353 1/4 (25%)
Ig_3 153..230 CDD:464046
LSAMPNP_001305844.1 Ig 38..128 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 61..65 CDD:409353
Ig strand E 94..98 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 121..124 CDD:409353
Ig_3 131..201 CDD:464046
Ig_3 218..294 CDD:464046 14/46 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.