DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and CG7166

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:243 Identity:59/243 - (24%)
Similarity:105/243 - (43%) Gaps:39/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HWIIFLGI----LCLLAGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTC 64
            :|.:.|.:    |.|:.|           .|:.....|.|..|.| .:.|.....:||:|::|.|
  Fly     8 YWTLVLYLFSFSLSLIGG-----------SFILPENDPPTTAPKF-LSRGHLYKVIVGETIELPC 60

  Fly    65 RVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQIS 129
            :|:|||:..:.|  .:...:||.|....|.||||:.:     .|:.|:|...:.:|:|.|.||:.
  Fly    61 KVQNLGSFVLLW--RKGSSVLTAGHLKITRDQRFKIV-----GDYNLQINGVKTQDAGDYICQLG 118

  Fly   130 TTPPIG--HSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDS 192
            ......  |:|.:.:...:..:....::...:|||:.|.|  |.:..|.||:.| ..:::  |..
  Fly   119 DQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLEC--KASGNPVPTIFW-FKKDV--FSG 178

  Fly   193 PRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHI 240
            |         ..:..:|.|:::......:|.|.|:..|.....|.:.|
  Fly   179 P---------THLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSMDI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 26/79 (33%)
V-set 52..143 CDD:284989 28/92 (30%)
IG_like 153..238 CDD:214653 19/84 (23%)
ig 153..232 CDD:278476 18/78 (23%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 28/89 (31%)
Ig 56..116 CDD:143165 21/66 (32%)
IG_like 144..221 CDD:214653 20/88 (23%)
IGc2 151..209 CDD:197706 18/71 (25%)
IG_like 232..313 CDD:214653
Ig 242..311 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.