DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and IGLON5

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001094842.1 Gene:IGLON5 / 402665 HGNCID:34550 Length:336 Species:Homo sapiens


Alignment Length:332 Identity:83/332 - (25%)
Similarity:116/332 - (34%) Gaps:90/332 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAM-HSPHAEDWTLRIR 114
            |.|...|....|:|.:.....| |:|:...:|  |..|...:|||.|...: ::|  |::::.|.
Human    41 NYTVCEGDNATLSCFIDEHVTR-VAWLNRSNI--LYAGNDRWTSDPRVRLLINTP--EEFSILIT 100

  Fly   115 YAQRKDSGIYECQISTT-PPIGHSVYL---------NIVEPVTDIIGGPELHINRGSTINLTCIV 169
            .....|.|:|.|...|. .|....|||         ||..|||         :|.|..:||.|:.
Human   101 EVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARIVNISSPVT---------VNEGGNVNLLCLA 156

  Fly   170 KFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPS---NA 231
            ...||  |||.|...|:           ...:|..:|..|.  :|:.   .:|.|.|...   |:
Human   157 VGRPE--PTVTWRQLRD-----------GFTSEGEILEISD--IQRG---QAGEYECVTHNGVNS 203

  Fly   232 NPTSVRVHIVDGEHPAAMHTGNNGNSTASQPPVLLPL----------VLLTCSTLML----LQLV 282
            .|.|.||.:                 |.:.||.:..:          .||.|..:.:    .|..
Human   204 APDSRRVLV-----------------TVNYPPTITDVTSARTALGRAALLRCEAMAVPPADFQWY 251

  Fly   283 ASCSTLVPATPPGCRTVQQAST-----FAEEKAMGQRSNRNCQDLQELEESQD----LRRRGVER 338
            .....|...|..|.: ||...|     ||...|. ...|..|:....|..|..    ||...:|.
Human   252 KDDRLLSSGTAEGLK-VQTERTRSMLLFANVSAR-HYGNYTCRAANRLGASSASMRLLRPGSLEN 314

  Fly   339 SA--VPG 343
            ||  .||
Human   315 SAPRPPG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 22/80 (28%)
V-set 52..143 CDD:284989 27/101 (27%)
IG_like 153..238 CDD:214653 22/87 (25%)
ig 153..232 CDD:278476 20/81 (25%)
IGLON5NP_001094842.1 Ig 41..129 CDD:416386 27/92 (29%)
Ig strand A' 41..46 CDD:409353 2/4 (50%)
Ig strand B 48..56 CDD:409353 2/7 (29%)
CDR1 56..60 CDD:409353 0/3 (0%)
FR2 61..68 CDD:409353 3/7 (43%)
Ig strand C 61..67 CDD:409353 3/6 (50%)
CDR2 69..79 CDD:409353 3/11 (27%)
Ig strand C' 71..74 CDD:409353 2/4 (50%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 11/36 (31%)
Ig strand D 84..91 CDD:409353 1/6 (17%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 4/8 (50%)
FR4 122..129 CDD:409353 3/6 (50%)
Ig_3 134..199 CDD:404760 24/91 (26%)
Ig strand B 148..157 CDD:409353 3/8 (38%)
Ig strand C 162..170 CDD:409353 4/7 (57%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig strand G 202..212 CDD:409353 5/9 (56%)
Ig_3 217..295 CDD:404760 17/79 (22%)
putative Ig strand A 218..224 CDD:409353 1/5 (20%)
Ig strand B 234..238 CDD:409353 2/3 (67%)
Ig strand C 247..251 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 0/3 (0%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.