Sequence 1: | NP_001285239.1 | Gene: | dpr8 / 32387 | FlyBaseID: | FBgn0052600 | Length: | 344 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001094842.1 | Gene: | IGLON5 / 402665 | HGNCID: | 34550 | Length: | 336 | Species: | Homo sapiens |
Alignment Length: | 332 | Identity: | 83/332 - (25%) |
---|---|---|---|
Similarity: | 116/332 - (34%) | Gaps: | 90/332 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 NITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAM-HSPHAEDWTLRIR 114
Fly 115 YAQRKDSGIYECQISTT-PPIGHSVYL---------NIVEPVTDIIGGPELHINRGSTINLTCIV 169
Fly 170 KFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPS---NA 231
Fly 232 NPTSVRVHIVDGEHPAAMHTGNNGNSTASQPPVLLPL----------VLLTCSTLML----LQLV 282
Fly 283 ASCSTLVPATPPGCRTVQQAST-----FAEEKAMGQRSNRNCQDLQELEESQD----LRRRGVER 338
Fly 339 SA--VPG 343 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr8 | NP_001285239.1 | IG_like | 51..131 | CDD:214653 | 22/80 (28%) |
V-set | 52..143 | CDD:284989 | 27/101 (27%) | ||
IG_like | 153..238 | CDD:214653 | 22/87 (25%) | ||
ig | 153..232 | CDD:278476 | 20/81 (25%) | ||
IGLON5 | NP_001094842.1 | Ig | 41..129 | CDD:416386 | 27/92 (29%) |
Ig strand A' | 41..46 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 48..56 | CDD:409353 | 2/7 (29%) | ||
CDR1 | 56..60 | CDD:409353 | 0/3 (0%) | ||
FR2 | 61..68 | CDD:409353 | 3/7 (43%) | ||
Ig strand C | 61..67 | CDD:409353 | 3/6 (50%) | ||
CDR2 | 69..79 | CDD:409353 | 3/11 (27%) | ||
Ig strand C' | 71..74 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
FR3 | 80..115 | CDD:409353 | 11/36 (31%) | ||
Ig strand D | 84..91 | CDD:409353 | 1/6 (17%) | ||
Ig strand E | 94..100 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 120..129 | CDD:409353 | 4/8 (50%) | ||
FR4 | 122..129 | CDD:409353 | 3/6 (50%) | ||
Ig_3 | 134..199 | CDD:404760 | 24/91 (26%) | ||
Ig strand B | 148..157 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 162..170 | CDD:409353 | 4/7 (57%) | ||
Ig strand F | 191..199 | CDD:409353 | 3/7 (43%) | ||
Ig strand G | 202..212 | CDD:409353 | 5/9 (56%) | ||
Ig_3 | 217..295 | CDD:404760 | 17/79 (22%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 1/5 (20%) | ||
Ig strand B | 234..238 | CDD:409353 | 2/3 (67%) | ||
Ig strand C | 247..251 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 274..278 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |