DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and dpr10

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:364 Identity:129/364 - (35%)
Similarity:187/364 - (51%) Gaps:96/364 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHA 106
            |.||.|:..|||.||||:..|.||||:|||:||:|:||||:|:||||.||||:||||:..:....
  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDI 117

  Fly   107 EDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVE--------------------------- 144
            ::|||:|::||::|:|:|||||||.|...:||.||||:                           
  Fly   118 DEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVY 182

  Fly   145 -------------------PVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINF 190
                               |...|:|||:|::::|||||||||:||:||||..:.|.|..::::.
  Fly   183 QSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSE 247

  Fly   191 DSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAAMHTGNNG 255
            ::..|.:...|.|...|.|.||:..|....||.|:|.|||....|:|||::.||.|.||.|    
  Fly   248 ETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQT---- 308

  Fly   256 NSTASQPPVLLPLVLLTC------------STLM-LLQLVASCSTLV--------------PA-- 291
                :..|..:.|...:|            ||:: .|.|:.:||:|:              ||  
  Fly   309 ----NAAPAAVALACWSCHFGQATQAVRVISTMVAALVLLEACSSLLLQSGGGGGCPGGGSPAGG 369

  Fly   292 TPPGCRTVQQ-------------ASTFAEEKAMGQRSNR 317
            .|...|.:::             ::|.||....|.|:.|
  Fly   370 MPTRVREIREKPLTNSLLDPKIPSTTSAERVNNGSRNAR 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 49/79 (62%)
V-set 52..143 CDD:284989 54/90 (60%)
IG_like 153..238 CDD:214653 35/84 (42%)
ig 153..232 CDD:278476 34/78 (44%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 49/79 (62%)
IG_like 210..297 CDD:214653 37/86 (43%)
IGc2 217..287 CDD:197706 30/69 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D413759at33208
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.