DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and CG13506

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:205 Identity:43/205 - (20%)
Similarity:73/205 - (35%) Gaps:67/205 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYE 125
            ||.||.....|.|:.| ...|::    |:.:...:|           :..:.:.....|::|.|:
  Fly   187 KLECRTYLPDNATIKW-SFNDLN----GQPSSVDNQ-----------NGVIILDNVDEKNAGDYQ 235

  Fly   126 CQI---STTPPIGHSVYLNIVEPVTDIIGGPELHIN--RGSTINLTCIVKFAP------------ 173
            |..   |..||.| :|::::  ..:.|:.....::|  :|:|..|.|..:..|            
  Fly   236 CLADDGSRHPPHG-TVHIDV
--QYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKT 297

  Fly   174 -------EPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNA 231
                   ....:|...|||                     ||  |:|::....|.|.|.|...||
  Fly   298 LQLSDKYSLKDSVHNDHNR---------------------TT--LIVREVTDSDLGEYLCQVENA 339

  Fly   232 -NPTSVRVHI 240
             ....|:||:
  Fly   340 IGSNEVKVHV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 15/72 (21%)
V-set 52..143 CDD:284989 19/84 (23%)
IG_like 153..238 CDD:214653 21/106 (20%)
ig 153..232 CDD:278476 20/100 (20%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653
IGc2 83..146 CDD:197706
IG_like 176..254 CDD:214653 19/83 (23%)
Ig 176..239 CDD:299845 14/67 (21%)
I-set 258..349 CDD:254352 23/113 (20%)
Ig 275..348 CDD:143165 18/95 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.