DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and wrapper

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:236 Identity:52/236 - (22%)
Similarity:94/236 - (39%) Gaps:47/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKD 120
            :|...::.|..:.:....::|..:.::    :...:.|.:::            :|.:....|..
  Fly   146 IGAIFEVVCEAQGVPQPVITWRLNGNV----IQPQSNTGNRQ------------SLILEIKSRNQ 194

  Fly   121 SGIYECQIS--TTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSH 183
            :|:.||..|  ...|...:|||:::......|..|.::...||..:|.|||:.|  |..||.|.|
  Fly   195 AGLIECVASNGVGEPAVANVYLHVL
FSPEVSIPQPVVYTKLGSRAHLECIVEAA--PAATVKWFH 257

  Fly   184 NREIINFDSPRGGISLVTEKGVLTTSR-----------LLVQKAI-TQDSGLYTCTPSNANPTSV 236
            :...:..     |....|.:..|.|:|           :||.|:: ..|.|.|.|..|  |..||
  Fly   258 HGLPVAL-----GAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRAS--NQISV 315

  Fly   237 RVHIVD--GEHPAAMHTGNNGNSTAS------QPPVLLPLV 269
            :...|:  |.....:...|.|..:::      |...|||::
  Fly   316 KSGSVELTGRPMPCLFKINPGTQSSTSHVLVWQTESLLPIM 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 10/76 (13%)
V-set 52..143 CDD:284989 14/88 (16%)
IG_like 153..238 CDD:214653 29/96 (30%)
ig 153..232 CDD:278476 26/90 (29%)
wrapperNP_477404.1 Ig 41..124 CDD:299845
IG_like 41..118 CDD:214653
IG_like 145..218 CDD:214653 14/87 (16%)
Ig 147..219 CDD:299845 14/87 (16%)
I-set 224..323 CDD:254352 31/107 (29%)
IGc2 236..314 CDD:197706 26/86 (30%)
FN3 339..431 CDD:238020 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.