DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and LRIT3

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_940908.3 Gene:LRIT3 / 345193 HGNCID:24783 Length:679 Species:Homo sapiens


Alignment Length:334 Identity:63/334 - (18%)
Similarity:109/334 - (32%) Gaps:94/334 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWT--------------LRIRY 115
            |..:|.|..::.|.:..:..|....|...|..|...:.....|.||              .||..
Human   132 RTLDLHNNKITSVPNEALRYLKNLAYLDLSSNRLTTLPPDFLESWTHLVSTPSGVLDLSPSRIIL 196

  Fly   116 AQRKDSGIYECQISTTPPIGHSVYLNIV-----------EPVTDII----------------GGP 153
            ..:.:....:|.||....:...|...||           |.:|.|:                ...
Human   197 GLQDNPWFCDCHISKMIELSKVVDPAIVLLDPLMTCSEPERLTGILFQRAELEHCLKPSVMTSAT 261

  Fly   154 ELHINRGSTINLTC-IVKFAPEPPPTVIWSH-NREIINF----DSPRGGI--SLVTEKGVLTTSR 210
            ::....||.:.|.| ...|   |.|.:.|:. :...:|:    :||..|:  |:::..|:     
Human   262 KIMSALGSNVLLRCDATGF---PTPQITWTRSDSSPVNYTVIQESPEEGVRWSIMSLTGI----- 318

  Fly   211 LLVQKAITQDSGLYTCTPSNANPTSVRVHIV-----------------DGEHPA-AMHTGNNGNS 257
                  .::|:|.|.|...|....|..|..|                 .|:||. .:..|:..::
Human   319 ------SSKDAGDYKCKAKNLAGMSEAVVTVTVLGITTTPIPPDTSERTGDHPEWDVQPGSGRST 377

  Fly   258 TASQPPVLL------PLVLLTCSTL-----MLLQLVASCSTLVPATPPGCRTVQQASTFAEEKA- 310
            :.|.....|      |....:.|||     ....|....|:.|.:|.....::..::|.|.::: 
Human   378 SVSSASSYLWSSSFSPTSSFSASTLSPPSTASFSLSPFSSSTVSSTTTLSTSISASTTMANKRSF 442

  Fly   311 -MGQRSNRN 318
             :.|...||
Human   443 QLHQGGKRN 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 16/79 (20%)
V-set 52..143 CDD:284989 17/91 (19%)
IG_like 153..238 CDD:214653 20/92 (22%)
ig 153..232 CDD:278476 19/86 (22%)
LRIT3NP_940908.3 LRR 1 56..79
leucine-rich repeat 59..82 CDD:275378
LRR_8 61..117 CDD:290566
LRR 2 80..103
leucine-rich repeat 83..106 CDD:275378
LRR 3 104..128
LRR_8 105..165 CDD:290566 7/32 (22%)
LRR_4 105..146 CDD:289563 4/13 (31%)
leucine-rich repeat 107..130 CDD:275378
LRR 4 129..151 4/18 (22%)
LRR_4 131..170 CDD:289563 8/37 (22%)
leucine-rich repeat 131..154 CDD:275378 5/21 (24%)
LRR 5 152..175 4/22 (18%)
leucine-rich repeat 155..168 CDD:275378 3/12 (25%)
Ig 267..345 CDD:299845 22/91 (24%)
IG_like 267..345 CDD:214653 22/91 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..375 4/23 (17%)
FN3 486..550 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.