DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and DIP-theta

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:218 Identity:68/218 - (31%)
Similarity:95/218 - (43%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQ 96
            :|||..|        .:..|:|..|.:...|.|.|.||....::|:|.....:||:..:..|.:.
  Fly   127 KDLPKFG--------ELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNH 183

  Fly    97 RFEAMHSPHAED--WTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGP---ELH 156
            |   |...|||.  |.||||..:..|.|.|.|||:|.|......||::|.| .||:..|   ::.
  Fly   184 R---MSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVP-PDILDYPTSTDMV 244

  Fly   157 INRGSTINLTCIVKFAPEPPPTVIW-SHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQD 220
            |..||.:.|.|..  ...|.||:.| ....|:|...:   |...|...|    |.|.:.|....:
  Fly   245 IREGSNVTLKCAA--TGSPTPTITWRREGGELIPLPN---GAEAVAYNG----SFLTIAKVNRLN 300

  Fly   221 SGLYTCTPSNANPTSV--RVHIV 241
            .|.|.|..||..|.:|  ||.::
  Fly   301 MGAYLCIASNGIPPTVSKRVMLI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 29/81 (36%)
V-set 52..143 CDD:284989 32/92 (35%)
IG_like 153..238 CDD:214653 25/90 (28%)
ig 153..232 CDD:278476 23/82 (28%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 33/95 (35%)
IG_like 137..230 CDD:214653 33/95 (35%)
IG_like 240..324 CDD:214653 26/93 (28%)
IGc2 247..310 CDD:197706 19/71 (27%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.