DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and DIP-beta

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:319 Identity:83/319 - (26%)
Similarity:120/319 - (37%) Gaps:80/319 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIIFLGILCLLAGCTD----------GASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKT 59
            |.:.|  |.||..|.|          ||   |..||:..|               .|:|...|:.
  Fly    70 WQLLL--LLLLGNCIDLTVSNKISSVGA---FEPDFVIPL---------------ENVTIAQGRD 114

  Fly    60 VKLTCRVKNLGNRTVS-----------WVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRI 113
            ...||.|.|||...||           |::.....:|.:..:..|::.|....|:.: ..|||.|
  Fly   115 ATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDY-NTWTLNI 178

  Fly   114 RYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIG---GPELHINRGSTINLTCIVKFAPEP 175
            |..:.:|:|.|.||::|.|....:..|.:|.| .|||.   ..::.:..|.:..|.|..:..|:|
  Fly   179 RGVKMEDAGKYMCQVNTDPMKMQTATLEVVIP-PDIINEETSGDMMVPEGGSAKLVCRARGHPKP 242

  Fly   176 PPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSV---- 236
            ..|......||||    .|.|....|:...:....|.:.|....:.|.|.|..||..|.:|    
  Fly   243 KITWRREDGREII----ARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRM 303

  Fly   237 --RVHIVDGEHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLVASCSTLVPATP 293
              :||.    ||           ....|..|:...:||..||:       |:  |.|:|
  Fly   304 KLQVHF----HP-----------LVQVPNQLVGAPVLTDVTLI-------CN--VEASP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 26/90 (29%)
V-set 52..143 CDD:284989 28/101 (28%)
IG_like 153..238 CDD:214653 22/90 (24%)
ig 153..232 CDD:278476 20/78 (26%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 32/126 (25%)
ig 102..195 CDD:278476 27/108 (25%)
IG_like 219..307 CDD:214653 22/91 (24%)
Ig 221..307 CDD:299845 22/89 (25%)
Ig 311..404 CDD:299845 11/48 (23%)
IG_like 327..405 CDD:214653 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.