DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and dpr18

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:298 Identity:82/298 - (27%)
Similarity:126/298 - (42%) Gaps:67/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GPTFD-----TTIGTNITGLVGKTVK--LTCRVKNLGNRTVSWVRH--RDIHLLTVGRYTYTSDQ 96
            ||.|:     .|.|.|:...|....:  |.|||..|.::||.|||.  ..:.|||||..||:.|.
  Fly   216 GPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDP 280

  Fly    97 RFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHI---- 157
            |...... :..:|.|.|...|.:|:|:|.||:||.||...:..|.::||...||...|..:    
  Fly   281 RIRVKFQ-YPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRY 344

  Fly   158 -NRGSTINLTCIV--KFAPEPPPTVIWSHN------REIIN------------------------ 189
             ..|||::|.|.:  .|..:...|::.|.:      :::||                        
  Fly   345 YKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDL 409

  Fly   190 ------------FDSPRGGIS--LVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHI 240
                        .:.|..|::  .::...|..|||:.:..|...|||.|:|:........|:|.:
  Fly   410 EKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQV 474

  Fly   241 VDGEHPAAMHTGNNGNST-----ASQPPVLLPLVLLTC 273
            :.||.|||:. .|.|:.|     |....:|:.:.|.||
  Fly   475 LTGELPAAVQ-HNIGSRTEIYSLAMLGHLLVLIFLFTC 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 31/83 (37%)
V-set 52..143 CDD:284989 34/94 (36%)
IG_like 153..238 CDD:214653 24/135 (18%)
ig 153..232 CDD:278476 23/129 (18%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 33/83 (40%)
Ig <258..326 CDD:299845 26/68 (38%)
IGc2 <417..461 CDD:197706 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.