DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and Igsf9b

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001363879.1 Gene:Igsf9b / 315510 RGDID:1564717 Length:1441 Species:Rattus norvegicus


Alignment Length:229 Identity:54/229 - (23%)
Similarity:91/229 - (39%) Gaps:38/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHA 106
            |||..|....|....|.::.:||.........|:|::...: |...|:|              ..
  Rat   139 PTFTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGTL-LSASGKY--------------QV 188

  Fly   107 EDWTLRIRYAQRKDSGIYECQ-ISTTPPIGHSVYLNIVEPVTDIIGGPE-LHINRGSTINLTCIV 169
            .|.:|.:....|:|.|.|.|: .|......|:.:| :|:....|:..|| :.:|......|||..
  Rat   189 SDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTTHL-LVQGPPFIVSPPENITVNISQDALLTCRA 252

  Fly   170 KFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNA--- 231
            :..| ...|..|....|.:.|.:     .|.....:|....|::.:...:|:|.|||.|||:   
  Rat   253 EAYP-GNLTYTWYWQDENVYFQN-----DLKLRVRILIDGTLIIFRVKPEDAGKYTCVPSNSLGR 311

  Fly   232 NPTSVRVHIVDGEHPAAMHTGNNGNSTASQPPVL 265
            :|::.....|  ::||.:         .:.|||:
  Rat   312 SPSASAYLTV--QYPARV---------LNMPPVI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 17/80 (21%)
V-set 52..143 CDD:284989 19/91 (21%)
IG_like 153..238 CDD:214653 23/88 (26%)
ig 153..232 CDD:278476 22/82 (27%)
Igsf9bNP_001363879.1 PHA03247 <898..1246 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1044
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1111..1332
Ig 41..115 CDD:319273
I-set 139..225 CDD:369462 23/101 (23%)
Ig 229..321 CDD:386229 24/97 (25%)
Ig <353..414 CDD:386229
Ig 438..502 CDD:319273
FN3 510..605 CDD:238020
FN3 621..703 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..821
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.