DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and Fas2

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:223 Identity:52/223 - (23%)
Similarity:80/223 - (35%) Gaps:60/223 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GPTFDTTIGTNITG-------LVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRF 98
            |.|..|.:....|.       .:|:...:.|.||...|.|:.|:|:.|....|..:|...::   
  Fly   129 GVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTN--- 190

  Fly    99 EAMHSPHAEDWTLRIRYAQRKDSGIYECQ---ISTTPPIGHSVYLNI-VEPVTDIIGGP-ELHIN 158
                       .|.||..|..|.|||.|:   |.|...:..::.:.: ::|  :||..| .|...
  Fly   191 -----------GLLIRNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQP--EIISLPTNLEAV 242

  Fly   159 RGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSR--------LLVQK 215
            .|......|..:  .:|.|.:.|               |...|:..|.|..|        |:...
  Fly   243 EGKPFAANCTAR--GKPVPEISW---------------IRDATQLNVATADRFQVNPQTGLVTIS 290

  Fly   216 AITQDS-GLYTCTPSNANPTSVRVHIVD 242
            :::||. |.|||...|      |..:||
  Fly   291 SVSQDDYGTYTCLAKN------RAGVVD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 22/89 (25%)
V-set 52..143 CDD:284989 23/101 (23%)
IG_like 153..238 CDD:214653 20/94 (21%)
ig 153..232 CDD:278476 20/88 (23%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 2/3 (67%)
IG_like 144..226 CDD:214653 22/95 (23%)
IGc2 152..209 CDD:197706 20/70 (29%)
I-set 230..319 CDD:254352 26/108 (24%)
IGc2 243..309 CDD:197706 19/88 (22%)
IG_like 330..424 CDD:214653
IGc2 339..412 CDD:197706
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.