DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and rst

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:359 Identity:70/359 - (19%)
Similarity:122/359 - (33%) Gaps:120/359 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VGKTVKLTCRVKNLGNRTVSWVRHRDIHLL-------------TVGRY----------TYTSDQR 97
            ||..|.|||.|.:.....:.|::|....::             |.|||          ..::|..
  Fly   359 VGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTFSVSNETAGRYYCKANVPGYAEISADAY 423

  Fly    98 FEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGST 162
            .....||..  .:.|.:|....|:...||..|:.|...|         |:....|.|:....|..
  Fly   424 VY
LKGSPAI--GSQRTQYGLVGDTARIECFASSVPRARH---------VSWTFNGQEISSESGHD 477

  Fly   163 INL-----------TCIVKFAP-----EPPPTVIWSHNREI--INFDSPR---------GGISLV 200
            .::           |.|::.:.     :...||:..:..::  |...:.:         ||||:|
  Fly   478 YSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISVV 542

  Fly   201 TEKGVLT----------------TSRLLVQKAITQDSGLYTC--TPSN--ANPTSVRVHIVDGEH 245
            ....|||                .:.::.:..||::.|: :|  .|.:  :|.:.::|.|..|..
  Fly   543 AFLLVLTILVVVYIKCKKRTKLPPADVISEHQITKNGGV-SCKLEPGDRTSNYSDLKVDISGGYV 606

  Fly   246 PAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLVASCSTLVPATPPGCRTVQQASTFAEEKA 310
            |...:      ||...||   |..|.||||                ...|..|:.          
  Fly   607 PYGDY------STHYSPP---PQYLTTCST----------------KSNGSSTIM---------- 636

  Fly   311 MGQRSNRNCQDLQELEESQDLRRRGVERSAVPGT 344
              |.:::|...||: ::.|...:...:.:.:|.|
  Fly   637 --QNNHQNQLQLQQ-QQQQSHHQHHTQTTTLPMT 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 22/97 (23%)
V-set 52..143 CDD:284989 24/109 (22%)
IG_like 153..238 CDD:214653 21/131 (16%)
ig 153..232 CDD:278476 20/125 (16%)
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638
I-set 346..420 CDD:254352 13/60 (22%)
Ig 360..425 CDD:299845 13/64 (20%)
Ig5_KIRREL3-like 428..524 CDD:143235 19/106 (18%)
IG_like 435..524 CDD:214653 17/97 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.