DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and ncam1a

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_009293555.1 Gene:ncam1a / 30447 ZFINID:ZDB-GENE-990415-31 Length:1010 Species:Danio rerio


Alignment Length:248 Identity:57/248 - (22%)
Similarity:89/248 - (35%) Gaps:55/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRY 115
            |.|..:.:.|.|.|........||.|.|         |.....||:::    |.:.:...|.|:.
Zfish   219 NATADINQAVTLACHADGYPEPTVKWAR---------GNTELESDEKY----SLNEDGSELTIKD 270

  Fly   116 AQRKDSGIYEC-QISTTPPIGHSVYLNI-VEPVTDII---GGPELHINRGSTINLTCIVKFAPEP 175
            ..:.|.|.|:| ..:........|.||: |:|....:   ...||.    ..|.|||  :...:|
Zfish   271 VNKLDEGDYKCIARNKAGERSEEVTLNVFVQPKITFLENQTASELE----EQITLTC--EATGDP 329

  Fly   176 PPTVIWSHNREII------NFDSPRGGISL---VTEKGVLTTSRLLVQKAITQDSGLYTCTPSNA 231
            .|.:|||..|.:.      ::..|....||   |..:.....|.|.::.....|:|.|.||..|:
Zfish   330 TPNIIWSFGRRVFTENEQASWTRPEKHKSLDGNVVVRSDARVSSLTLKYVQFTDAGQYLCTARNS 394

  Fly   232 NPTSVRVHIVDGEH------PAAMHT--GNNGNSTASQPPVLLPLVLLTCSTL 276
            ....::...::..:      |.|:.|  ||..|              :||..|
Zfish   395 IGQDIQSMYLEVRYAPKIQGPQAVFTWEGNPAN--------------ITCEAL 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 19/80 (24%)
V-set 52..143 CDD:284989 21/92 (23%)
IG_like 153..238 CDD:214653 24/93 (26%)
ig 153..232 CDD:278476 24/87 (28%)
ncam1aXP_009293555.1 Ig 20..112 CDD:299845
I-set 21..111 CDD:254352
IG_like 121..200 CDD:214653
IGc2 128..189 CDD:197706
Ig 208..301 CDD:299845 22/94 (23%)
IG_like 219..298 CDD:214653 21/91 (23%)
Ig 300..406 CDD:299845 26/111 (23%)
IG_like 308..406 CDD:214653 24/103 (23%)
ig 413..498 CDD:278476 9/35 (26%)
IG_like 415..498 CDD:214653 9/33 (27%)
fn3 505..589 CDD:278470
FN3 624..715 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.