DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and dpr1

DIOPT Version :10

Sequence 1:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:325 Identity:114/325 - (35%)
Similarity:167/325 - (51%) Gaps:42/325 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIIFLGILCLLAGCTDGASKRFFTDFLQDLPTPGTGG----------PTFDTTIGTNITGLVGKT 59
            |::.|.:: ||.|.....:           |||.|..          |.||..:..|:|..||:|
  Fly    18 WLLLLSMV-LLRGYNAALA-----------PTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQT 70

  Fly    60 VKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIY 124
            ..|.|||:.||::.|||:|.||:|:||.|..||||||||:.:....:.:|||:|:|.|.:|||:|
  Fly    71 GFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVY 135

  Fly   125 ECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIIN 189
            ||||:|.|.:..|...|:||...:|.|..:|.:..||.|||||.:...|.....:.|....|:::
  Fly   136 ECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLD 200

  Fly   190 ------FDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAA 248
                  .||....|.:..:.....||||.:::|:..|:|.|||.|:.|..:||.||::.||||||
  Fly   201 GKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAA 265

  Fly   249 MHTGNNGNSTASQPPVLLPLVLLTCS-TLMLLQLVASCSTLVPATPPGCRTVQQASTFAEEKAMG 312
            |...::.||.:           ..|. ..|||.:|:.|  |......||..:..|:..|:...:|
  Fly   266 MQHNSSSNSNS-----------FYCGICCMLLSIVSCC--LQHFYETGCGYLHAAAALAKSAGLG 317

  Fly   313  312
              Fly   318  317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_727781.1 IG_like 51..131 CDD:214653 43/79 (54%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 2/3 (67%)
Ig strand E 109..113 CDD:409353 3/3 (100%)
Ig strand F 123..128 CDD:409353 3/4 (75%)
Ig_3 153..230 CDD:464046 25/82 (30%)
dpr1NP_995908.2 Ig 53..138 CDD:472250 43/84 (51%)
Ig strand A' 63..65 CDD:409355 0/1 (0%)
Ig strand B 69..77 CDD:409355 3/7 (43%)
CDR1 77..83 CDD:409355 3/5 (60%)
Ig strand C 84..90 CDD:409355 3/5 (60%)
CDR2 93..109 CDD:409355 10/15 (67%)
Ig strand D 109..114 CDD:409355 1/4 (25%)
FR3 110..147 CDD:409355 16/36 (44%)
Ig strand E 119..125 CDD:409355 3/5 (60%)
Ig strand F 133..148 CDD:409355 8/14 (57%)
CDR3 148..160 CDD:409355 4/11 (36%)
IG_like 163..257 CDD:214653 29/93 (31%)
Ig strand B 174..178 CDD:409355 3/3 (100%)
Ig strand C 189..193 CDD:409355 0/3 (0%)
Ig strand E 226..230 CDD:409355 3/3 (100%)
Ig strand F 240..244 CDD:409355 2/3 (67%)

Return to query results.
Submit another query.