DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and dpr1

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:325 Identity:114/325 - (35%)
Similarity:167/325 - (51%) Gaps:42/325 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIIFLGILCLLAGCTDGASKRFFTDFLQDLPTPGTGG----------PTFDTTIGTNITGLVGKT 59
            |::.|.:: ||.|.....:           |||.|..          |.||..:..|:|..||:|
  Fly    18 WLLLLSMV-LLRGYNAALA-----------PTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQT 70

  Fly    60 VKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIY 124
            ..|.|||:.||::.|||:|.||:|:||.|..||||||||:.:....:.:|||:|:|.|.:|||:|
  Fly    71 GFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVY 135

  Fly   125 ECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIIN 189
            ||||:|.|.:..|...|:||...:|.|..:|.:..||.|||||.:...|.....:.|....|:::
  Fly   136 ECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLD 200

  Fly   190 ------FDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAA 248
                  .||....|.:..:.....||||.:::|:..|:|.|||.|:.|..:||.||::.||||||
  Fly   201 GKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAA 265

  Fly   249 MHTGNNGNSTASQPPVLLPLVLLTCS-TLMLLQLVASCSTLVPATPPGCRTVQQASTFAEEKAMG 312
            |...::.||.:           ..|. ..|||.:|:.|  |......||..:..|:..|:...:|
  Fly   266 MQHNSSSNSNS-----------FYCGICCMLLSIVSCC--LQHFYETGCGYLHAAAALAKSAGLG 317

  Fly   313  312
              Fly   318  317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 43/79 (54%)
V-set 52..143 CDD:284989 46/90 (51%)
IG_like 153..238 CDD:214653 28/90 (31%)
ig 153..232 CDD:278476 25/84 (30%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 47/94 (50%)
IG_like 60..150 CDD:214653 46/89 (52%)
IG_like 163..257 CDD:214653 29/93 (31%)
Ig 174..244 CDD:143165 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.