DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and Lsamp

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:302 Identity:75/302 - (24%)
Similarity:119/302 - (39%) Gaps:79/302 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTHWI-------IFLGILCL--LAGCTDGASKRFFTD-----FLQDLPTPGT------------ 39
            |.|:|:       .||.:..|  ||         |:..     .|..:..|||            
Mouse     1 MRTYWLHSVWVLGFFLSLFSLQVLA---------FWNQPPAEVNLSPITIPGTEETMRKKAKEEE 56

  Fly    40 GGP--TFDTTIGT-NITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAM 101
            |.|  :.|...|| |||...|.|..|.|.|:: .|..|:|:....|  :..|...::.|.|.| :
Mouse    57 GLPVRSVDFNRGTDNITVRQGDTAILRCVVED-KNSKVAWLNRSGI--IFAGHDKWSLDPRVE-L 117

  Fly   102 HSPHAEDWTLRIRYAQRKDSGIYECQISTT-PPIGHSVYLNIVEP--VTDIIGGPELHINRGSTI 163
            ...||.:::|||:.....|.|.|.|.:.|. .|....|||.:..|  :::|  ..::.:|.||.:
Mouse   118 EKRHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNI--SSDVTVNEGSNV 180

  Fly   164 NLTCIVKFAPEPPPTVIWSH----NREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQD-SGL 223
            .|.|:....||  |.:.|.|    .||   |:.....:.::               .||:: ||.
Mouse   181 TLVCMANGRPE--PVITWRHLTPLGRE---FEGEEEYLEIL---------------GITREQSGK 225

  Fly   224 YTCTPSN----ANPTSVRVHIVDGEHPAAMHTGNNGNSTASQ 261
            |.|..:|    |:...|:|.:   .:|..:....:..:|..:
Mouse   226 YECKAANEVSSADVKQVKVTV---NYPPTITESKSNEATTGR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 25/79 (32%)
V-set 52..143 CDD:284989 29/91 (32%)
IG_like 153..238 CDD:214653 22/93 (24%)
ig 153..232 CDD:278476 20/87 (23%)
LsampXP_030104997.1 Ig 69..159 CDD:386229 31/93 (33%)
Ig_3 163..232 CDD:372822 20/90 (22%)
Ig_3 250..325 CDD:372822 1/15 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.