Sequence 1: | NP_001285239.1 | Gene: | dpr8 / 32387 | FlyBaseID: | FBgn0052600 | Length: | 344 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001274153.1 | Gene: | Lrit3 / 242235 | MGIID: | 2685267 | Length: | 681 | Species: | Mus musculus |
Alignment Length: | 233 | Identity: | 51/233 - (21%) |
---|---|---|---|
Similarity: | 79/233 - (33%) | Gaps: | 61/233 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 TNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWT-LRI 113
Fly 114 RYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPT 178
Fly 179 VIWSHNREIINFDSPRGGI--SLVTEKGVLTTSRLLVQKAITQDSGLYTCT----PSNANP---- 233
Fly 234 ----TSVRVHIVDGEHPAAMHTGNNGNSTASQPPVLLP 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr8 | NP_001285239.1 | IG_like | 51..131 | CDD:214653 | 18/80 (23%) |
V-set | 52..143 | CDD:284989 | 20/91 (22%) | ||
IG_like | 153..238 | CDD:214653 | 20/98 (20%) | ||
ig | 153..232 | CDD:278476 | 16/84 (19%) | ||
Lrit3 | NP_001274153.1 | LRR 1. /evidence=ECO:0000255 | 56..79 | ||
LRR_8 | 61..117 | CDD:290566 | |||
LRR 2. /evidence=ECO:0000255 | 80..103 | ||||
leucine-rich repeat | 83..106 | CDD:275378 | |||
LRR 3. /evidence=ECO:0000255 | 104..128 | ||||
LRR_8 | 105..165 | CDD:290566 | |||
LRR_4 | 106..146 | CDD:289563 | |||
leucine-rich repeat | 107..130 | CDD:275378 | |||
LRR_4 | 129..170 | CDD:289563 | |||
LRR 4. /evidence=ECO:0000255 | 129..151 | ||||
leucine-rich repeat | 131..154 | CDD:275378 | |||
LRR 5. /evidence=ECO:0000255 | 152..175 | ||||
leucine-rich repeat | 155..168 | CDD:275378 | |||
Ig | 254..335 | CDD:299845 | 19/83 (23%) | ||
IG_like | 263..339 | CDD:214653 | 19/85 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 350..391 | 9/59 (15%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 425..464 | 11/34 (32%) | |||
FN3 | 489..563 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |