DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and IGSF9B

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:229 Identity:55/229 - (24%)
Similarity:91/229 - (39%) Gaps:38/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHA 106
            |||..|....|....|.::.:||.........|:|::...: |...|:|              ..
Human   139 PTFTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGTL-LGASGKY--------------QV 188

  Fly   107 EDWTLRIRYAQRKDSGIYECQ-ISTTPPIGHSVYLNIVEPVTDIIGGPE-LHINRGSTINLTCIV 169
            .|.:|.:....|:|.|.|.|: .|......|:.:| :|:....|:..|| :.:|......|||..
Human   189 SDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTTHL-LVQGPPFIVSPPENITVNISQDALLTCRA 252

  Fly   170 KFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNA--- 231
            :..| ...|..|....|.:.|.:     .|.....:|....|::.:...:|||.|||.|||:   
Human   253 EAYP-GNLTYTWYWQDENVYFQN-----DLKLRVRILIDGTLIIFRVKPEDSGKYTCVPSNSLGR 311

  Fly   232 NPTSVRVHIVDGEHPAAMHTGNNGNSTASQPPVL 265
            :|::.....|  ::||.:         .:.|||:
Human   312 SPSASAYLTV--QYPARV---------LNMPPVI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 17/80 (21%)
V-set 52..143 CDD:284989 19/91 (21%)
IG_like 153..238 CDD:214653 24/88 (27%)
ig 153..232 CDD:278476 23/82 (28%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653
Ig 41..115 CDD:143165
I-set 139..225 CDD:254352 23/101 (23%)
IGc2 153..210 CDD:197706 15/71 (21%)
I-set 229..321 CDD:254352 25/97 (26%)
Ig 235..321 CDD:299845 24/91 (26%)
IG_like 331..414 CDD:214653 3/4 (75%)
Ig <353..414 CDD:299845
IG_like 426..505 CDD:214653
Ig 442..505 CDD:299845
FN3 510..601 CDD:238020
FN3 617..699 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.