DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and zig-2

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:226 Identity:47/226 - (20%)
Similarity:77/226 - (34%) Gaps:73/226 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSW------VRHRDI-----HLLTVGR 89
            ||.....||            |:...|:|........::.|      ::..:.     ::|..|:
 Worm    38 TPNDSNVTF------------GEKFVLSCGANGAPLPSIYWELNGMRIQGEETSNVYENILNDGK 90

  Fly    90 YTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDI-IGGP 153
            ....:     ||.|.|     .||..|..::||.|:|.|...        |..:|.|..: :||.
 Worm    91 QVSNA-----AMVSSH-----YRIPCATARNSGAYKCIIDNG--------LTKLEHVAKVFVGGN 137

  Fly   154 E----LHINRGSTINLTCIVKFAPEPPPTVI-----------WSHNREIINFDSPRGGISLVTEK 203
            :    |:.|....|::|  |.|..|.....:           ||.::          |..|:|..
 Worm   138 KTNCALNDNGAPFISMT--VDFRLEISNNAVALSCRSETATEWSWHK----------GEQLLTND 190

  Fly   204 G----VLTTSRLLVQKAITQDSGLYTCTPSN 230
            |    :..:..|:::.....|.|.|.||..|
 Worm   191 GERYQMFPSGDLIIRNISWSDMGEYNCTARN 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 18/90 (20%)
V-set 52..143 CDD:284989 19/101 (19%)
IG_like 153..238 CDD:214653 20/97 (21%)
ig 153..232 CDD:278476 20/97 (21%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 25/125 (20%)
Ig 34..121 CDD:299845 22/104 (21%)
Ig <179..232 CDD:299845 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.