DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and zig-10

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:257 Identity:61/257 - (23%)
Similarity:91/257 - (35%) Gaps:38/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHA------EDWTLRIR 114
            :|.|..|.|......|  |:|.|.:.:.....|......::|     .|..      |...|.|.
 Worm    38 IGSTTALECEPYTSSN--VTWYRDKHVIATVEGHKNAILNER-----KPRGGEERIPEIGFLVIF 95

  Fly   115 YAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHI-----NRGSTINLTCIVKFAPE 174
            ..|::|.|.|.||.......|....|.|.. |.:|....::.:     ..|.::.|.|.:..| .
 Worm    96 DVQKEDEGNYYCQRENDSKWGEV
FQLKIAY-VDEISQNEKIKLEPNVPTLGRSLVLHCPIPKA-Y 158

  Fly   175 PPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSN-ANPTSVRV 238
            |||.|.|:.|      ..|...||  ::........|::........|.:.|..:| |...|...
 Worm   159 PPPKVTWTVN------SLPISHIS--SDYVAFPNGTLIISHFSYHHFGYFECNINNFAGHASTNT 215

  Fly   239 HIVDGEHPAAMH----TGNNGNSTASQPPVLLPLVLLTC---STLMLLQLVASCSTLVPATP 293
            .|...|..|.:.    |..||.|.|.:..:.  :.||.|   |..:|:.|:.:...|.|..|
 Worm   216 FIDSRELVANLESLKPTFVNGCSAALRSSLF--MFLLGCLITSGAVLIYLICAVCLLKPGRP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 20/80 (25%)
V-set 52..143 CDD:284989 22/92 (24%)
IG_like 153..238 CDD:214653 19/90 (21%)
ig 153..232 CDD:278476 17/84 (20%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 21/86 (24%)
IGc2 38..111 CDD:197706 20/79 (25%)
IG_like 143..215 CDD:214653 19/80 (24%)
IGc2 145..209 CDD:197706 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.