DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and Ncam2

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus


Alignment Length:229 Identity:59/229 - (25%)
Similarity:90/229 - (39%) Gaps:49/229 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDS 121
            |:..::.|||.:.....|||:.|.:       ..|...|.||..:.:.:     |:|....:.|.
Mouse   129 GEDAEVVCRVSSSPAPAVSWLYHNE-------EVTTIPDNRFAVLANNN-----LQILNINKSDE 181

  Fly   122 GIYECQ--ISTTPPIGHSVYLNIVEPVTDIIGGPELHIN----RGSTINLTCIVKFAPEPPPTVI 180
            |||.|:  :.....|.....:.||. |...|..|:...|    ||..:.|||  |.:..|.||:.
Mouse   182 GIYRCEGRVEAR
GEIDFRDIIVIVN-VPPAIMMPQKSFNATAERGEEMTLTC--KASGSPDPTIS 243

  Fly   181 WSHNREIINFDSPRGGISLVTEKGVL--TTSRLLVQKAITQDSGLYTCTPSNAN---------PT 234
            |..|.::|.          ..||.:|  :.:.|.|:..|.:|.|.|.|..:|..         ..
Mouse   244 WFRNGKLIE----------ENEKYILKGSNTELTVRNIINKDGGSYVCKATNKAGEDQKQAFLQV 298

  Fly   235 SVRVHIVDGEHPAAMHTGNNGNST----ASQPPV 264
            .|:.||:..::..   |..||:.|    |...||
Mouse   299 FVQPHILQLKNET---TSENGHVTLVCEAEGEPV 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 19/75 (25%)
V-set 52..143 CDD:284989 20/87 (23%)
IG_like 153..238 CDD:214653 26/99 (26%)
ig 153..232 CDD:278476 25/84 (30%)
Ncam2NP_001106679.1 Ig1_NCAM-2 21..112 CDD:143274
I-set 22..111 CDD:254352
I-set 117..193 CDD:254352 19/75 (25%)
IGc2 128..189 CDD:197706 19/71 (27%)
Ig 208..301 CDD:299845 26/104 (25%)
I-set 215..298 CDD:254352 24/94 (26%)
Ig 300..397 CDD:299845 10/33 (30%)
IG_like 308..395 CDD:214653 7/25 (28%)
IG_like 413..491 CDD:214653
IGc2 414..482 CDD:197706
FN3 496..588 CDD:238020
fn3 594..678 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.