DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and rig-5

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:237 Identity:61/237 - (25%)
Similarity:103/237 - (43%) Gaps:39/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFLGILCLL-AGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLG 70
            :..|:|.:. ..|:.||.                  ||......::...|:|:.|..||.|.:||
 Worm    66 LLCGVLLVFKQACSRGAP------------------PTIQQPSMSSAVALLGQDVDFTCIVNDLG 112

  Fly    71 NRTVSWVR-HRDIHLLTVGRYTYTSDQRFEA------MHSPHAEDWTLRIRYAQRKDSGIYECQI 128
            :..|::|: .....||:.....:....::|.      :|:    :|.|.|:..|..|.|.|.|||
 Worm   113 SHMVAFVKADSPPRLLSFDEKVFRRRNKYELKPRIGDLHN----EWVLTIKNVQESDRGNYSCQI 173

  Fly   129 STTPPIGHSVYLNI-VEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIW-SHNREIINFD 191
            :|.|....:..|:: |.||........:.:..|:.::|||  |....|.||||| ..:|:||.::
 Worm   174 NTEPITLSTGELDVKVPPVVSRSTPAAVEVREGNNVSLTC--KADGNPTPTVIWRRQDRQIIRYN 236

  Fly   192 SPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANP 233
            ...|..:.|....||..:: :.:|.:::    |.|..||..|
 Worm   237 GATGFGASVFHGPVLHLTK-VSRKHMSE----YLCVASNGIP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 24/86 (28%)
V-set 52..143 CDD:284989 27/98 (28%)
IG_like 153..238 CDD:214653 24/82 (29%)
ig 153..232 CDD:278476 23/79 (29%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 27/100 (27%)
Ig_3 191..270 CDD:372822 23/85 (27%)
IG 294..380 CDD:214652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.