DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and ntm

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:398 Identity:83/398 - (20%)
Similarity:127/398 - (31%) Gaps:148/398 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STHWIIFLG--ILCLLAGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTC 64
            |..|:||.|  :||||.|                  .|...|.........|:|...|.:..|.|
 Frog    12 SVPWVIFSGMAVLCLLQG------------------VPVRSGDAGFPKAMDNVTVRQGDSAILRC 58

  Fly    65 RVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQIS 129
            .|.|...| |:|:....|  |..|...::.|.|...:.:..:: :::.|:.....|.|.|.|.:.
 Frog    59 TVDNRVTR-VAWLNRSTI--LYTGNDKWSIDPRVVLLANTKSQ-YSIEIQNVDIYDEGPYTCSVQ 119

  Fly   130 T-TPPIGHSVYLNIVEP--VTDIIGGPELHINRGSTINLTCIVKFAPEP---------------- 175
            | ..|....|:|.:..|  :.||  ...:.:|.||.::|.||....|||                
 Frog   120 TDNHPKTSRVHLIVQVPPRIVDI--SSSIAVNEGSNVSLICIANGRPEPVVNWRYLSPKARGFVS 182

  Fly   176 ----------------------------------------PPTVIWSHN-------REIIN---- 189
                                                    ||.::.:.|       |.|:.    
 Frog   183 EDEYLEITGITREQSGIYECSASNDVSAPDVRRVKLTVNYPPYILDAQNIGAPLGHRGILQCEAS 247

  Fly   190 ----------------FDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSN----ANPT 234
                            .||.||    |..:...|.||:.......||.|.|||...|    :|.:
 Frog   248 AVPAADFFWYKEDKRLSDSWRG----VKVENRETISRVTFLNVSEQDYGNYTCMAKNLLGHSNAS 308

  Fly   235 SVRVHIVDG-----------------EHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLV 282
            .:...:...                 :.|.|:|.||:|::..|           .|:.|::|.|:
 Frog   309 IILFELFQSTSSPLLQEESTAALTPLKGPGAVHDGNSGSTQCS-----------FCAPLLILLLL 362

  Fly   283 ASCSTLVP 290
            ...|.|:|
 Frog   363 LPFSLLLP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 21/80 (26%)
V-set 52..143 CDD:284989 23/91 (25%)
IG_like 153..238 CDD:214653 30/171 (18%)
ig 153..232 CDD:278476 29/165 (18%)
ntmXP_004916061.1 Ig 45..133 CDD:299845 24/91 (26%)
IG_like 45..133 CDD:214653 24/91 (26%)
IG_like 143..220 CDD:214653 9/76 (12%)
IGc2 150..209 CDD:197706 8/58 (14%)
ig 227..311 CDD:278476 19/87 (22%)
IG_like 230..311 CDD:214653 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.