DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and si:ch211-264f5.6

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_002665524.2 Gene:si:ch211-264f5.6 / 100319064 ZFINID:ZDB-GENE-081104-208 Length:540 Species:Danio rerio


Alignment Length:258 Identity:63/258 - (24%)
Similarity:92/258 - (35%) Gaps:72/258 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PTFDTTIGTNITGLV--GKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSP 104
            |..|..|.:|:...|  ..||.|||..|  |:.|..|: :..:.|:..|.:     .:..|:.: 
Zfish   131 PVTDVKISSNVLEPVEFNSTVVLTCSAK--GSFTYKWI-NGSVPLVVDGTH-----MQLNAVGN- 186

  Fly   105 HAEDWTLRIRYAQRKD-SGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPE----------LHIN 158
                 .|:|...:|.| .|...|........|.|...|:.     :..|||          .::.
Zfish   187 -----ELKISEVRRTDLQGPIVCIAENALESGKSAPFNLT-----VSYGPENILMNQFPTDTYLK 241

  Fly   159 RGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGL 223
            :|||:.|||...  ..||.|:.|..|           |::| ....|.:.:...:.....::||.
Zfish   242 KGSTLTLTCTAD--SNPPATIQWVFN-----------GVNL-PSNAVSSPANFTLNNLEEKNSGN 292

  Fly   224 YTCTPSNANP---TSVRVHIVDGEHPAAMHTGNN----------GNSTASQPPVLLPLVLLTC 273
            |||...||..   .:.||..|.   .....:|.|          ||||          |.|||
Zfish   293 YTCVAYNAQTKRYIASRVAFVT---VVESLSGTNISSSTSLLIAGNST----------VNLTC 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 20/82 (24%)
V-set 52..143 CDD:284989 22/93 (24%)
IG_like 153..238 CDD:214653 23/97 (24%)
ig 153..232 CDD:278476 22/88 (25%)
si:ch211-264f5.6XP_002665524.2 Ig 33..129 CDD:299845
IG_like 33..128 CDD:214653
Ig 130..222 CDD:299845 26/109 (24%)
IG_like 149..222 CDD:214653 21/91 (23%)
I-set 233..315 CDD:254352 24/98 (24%)
Ig_2 235..315 CDD:290606 24/96 (25%)
IGc2 335..398 CDD:197706 7/18 (39%)
Ig_2 427..494 CDD:290606
IG_like 427..479 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.