DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and ncam2

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_012811963.1 Gene:ncam2 / 100151722 XenbaseID:XB-GENE-1217730 Length:865 Species:Xenopus tropicalis


Alignment Length:307 Identity:69/307 - (22%)
Similarity:114/307 - (37%) Gaps:100/307 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SKRFFTD---FLQDLPTPGTGGPTFDTTIGTNITGLVGKT------VKLTCRVKNLGNRTVSWVR 78
            :|..||:   |||....|             :|..|..:|      |.|||..:......::|.|
 Frog   314 NKAGFTEKQSFLQVFVQP-------------HIVQLQNETTIEHGHVTLTCEAEGEPIPEITWKR 365

  Fly    79 HRDIHLLTVGRYTYTSDQ----RFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGH--S 137
            ..|      |...|..|:    |.|:  :.|....:|.|:.....|:|.|:|:.::... ||  |
 Frog   366 SSD------GMIFYDGDKSQDGRIES--TGHHGKSSLHIKSVMLSDAGRYDCEAASRIG-GHQKS 421

  Fly   138 VYLNIVEPVTDIIGGPELHIN-RGSTINLTCIVKFAPEPPPTVIWSHN------REIINFDSPRG 195
            :|||| |.....|....::.: ..:.||::|.|  ...||.::.||.:      |.|.|..:.|.
 Frog   422 MYLNI-EYAPKFISNQTIYYSWENNPINISCDV--TSNPPSSIYWSRDKLLLPARNITNIKTYRD 483

  Fly   196 GISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAAMHTGNNGNSTAS 260
            |..::.|...|:.:          |.|.|.||..|:..:.::.:|                    
 Frog   484 GKRILLEITPLSDN----------DFGRYNCTAINSIGSRIQEYI-------------------- 518

  Fly   261 QPPVLLPLVLLTCSTLMLLQLVASCSTLVPATPPGCRTVQQASTFAE 307
                      ||.:.             ||::|.|.|.::.:.|:|:
 Frog   519 ----------LTLAD-------------VPSSPYGLRVIELSQTYAK 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 22/89 (25%)
V-set 52..143 CDD:284989 28/102 (27%)
IG_like 153..238 CDD:214653 21/91 (23%)
ig 153..232 CDD:278476 21/85 (25%)
ncam2XP_012811963.1 Ig 50..141 CDD:386229
IG_like 150..234 CDD:214653
Ig 237..330 CDD:386229 6/15 (40%)
Ig 329..426 CDD:386229 28/118 (24%)
IG_like 442..520 CDD:214653 22/119 (18%)
FN3 525..617 CDD:238020 6/18 (33%)
fn3 623..706 CDD:365830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.