Sequence 1: | NP_001285239.1 | Gene: | dpr8 / 32387 | FlyBaseID: | FBgn0052600 | Length: | 344 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005157551.1 | Gene: | dscaml1 / 100002762 | -ID: | - | Length: | 2158 | Species: | Danio rerio |
Alignment Length: | 216 | Identity: | 56/216 - (25%) |
---|---|---|---|
Similarity: | 80/216 - (37%) | Gaps: | 58/216 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 NITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRY 115
Fly 116 AQRKDSGIYECQIST----------------TPPIGHSVYLNIVEPVTDIIGGPELHINRGSTIN 164
Fly 165 LTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPS 229
Fly 230 NA-------------NPTSVR 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr8 | NP_001285239.1 | IG_like | 51..131 | CDD:214653 | 25/95 (26%) |
V-set | 52..143 | CDD:284989 | 28/106 (26%) | ||
IG_like | 153..238 | CDD:214653 | 25/98 (26%) | ||
ig | 153..232 | CDD:278476 | 22/91 (24%) | ||
dscaml1 | XP_005157551.1 | IG_like | 112..184 | CDD:214653 | |
Ig | 112..183 | CDD:143165 | |||
Ig | 194..287 | CDD:299845 | |||
I-set | 302..380 | CDD:254352 | |||
IGc2 | 309..370 | CDD:197706 | |||
IGc2 | 399..458 | CDD:197706 | 24/70 (34%) | ||
I-set | 477..571 | CDD:254352 | 27/110 (25%) | ||
Ig | 477..567 | CDD:299845 | 27/106 (25%) | ||
IG_like | 581..662 | CDD:214653 | |||
IGc2 | 588..646 | CDD:197706 | |||
Ig | 684..751 | CDD:143165 | |||
IG_like | 686..756 | CDD:214653 | |||
I-set | 760..855 | CDD:254352 | |||
Ig7_DSCAM | 778..855 | CDD:143211 | |||
IG_like | 865..956 | CDD:214653 | |||
Ig | 873..963 | CDD:299845 | |||
FN3 | 959..1053 | CDD:238020 | |||
FN3 | 1060..1157 | CDD:238020 | |||
FN3 | 1165..1271 | CDD:238020 | |||
FN3 | 1276..1367 | CDD:238020 | |||
IGc2 | 1392..1455 | CDD:197706 | |||
FN3 | 1486..1559 | CDD:238020 | |||
FN3 | 1573..1649 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |