DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr8 and dscaml1

DIOPT Version :9

Sequence 1:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_005157551.1 Gene:dscaml1 / 100002762 -ID:- Length:2158 Species:Danio rerio


Alignment Length:216 Identity:56/216 - (25%)
Similarity:80/216 - (37%) Gaps:58/216 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRY 115
            |:...:..||.|:|.|:...:.||||.|:.:         ....||.| ::...|.|  ||.|..
Zfish   392 NLKTGISSTVILSCAVQGSPHFTVSWFRNTE---------PIVPDQHF-SIQGAHNE--TLFITA 444

  Fly   116 AQRKDSGIYECQIST----------------TPPIGHSVYLNIVEPVTDIIGGPELHINRGSTIN 164
            ||::.||.|:|..:.                ||.|..|....:|.|              |...:
Zfish   445 AQKRHSGAYQCFATRKGQTAQDFSIILLEDGTPRIVSSFSERVVAP--------------GEPFS 495

  Fly   165 LTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPS 229
            |.|..|.|  ||||:.|:.:.|.:..||...........| .|.|.:.|.....:|.|:|.|...
Zfish   496 LMCAAKGA--PPPTITWTLDDEPVARDSAHRASQYTLSDG-STVSHVNVTNPQIRDGGVYRCAAR 557

  Fly   230 NA-------------NPTSVR 237
            |:             .|.|:|
Zfish   558 NSAGSAEYQARINVRGPPSIR 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 25/95 (26%)
V-set 52..143 CDD:284989 28/106 (26%)
IG_like 153..238 CDD:214653 25/98 (26%)
ig 153..232 CDD:278476 22/91 (24%)
dscaml1XP_005157551.1 IG_like 112..184 CDD:214653
Ig 112..183 CDD:143165
Ig 194..287 CDD:299845
I-set 302..380 CDD:254352
IGc2 309..370 CDD:197706
IGc2 399..458 CDD:197706 24/70 (34%)
I-set 477..571 CDD:254352 27/110 (25%)
Ig 477..567 CDD:299845 27/106 (25%)
IG_like 581..662 CDD:214653
IGc2 588..646 CDD:197706
Ig 684..751 CDD:143165
IG_like 686..756 CDD:214653
I-set 760..855 CDD:254352
Ig7_DSCAM 778..855 CDD:143211
IG_like 865..956 CDD:214653
Ig 873..963 CDD:299845
FN3 959..1053 CDD:238020
FN3 1060..1157 CDD:238020
FN3 1165..1271 CDD:238020
FN3 1276..1367 CDD:238020
IGc2 1392..1455 CDD:197706
FN3 1486..1559 CDD:238020
FN3 1573..1649 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.