DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaNACtes2 and BTF3L4

DIOPT Version :9

Sequence 1:NP_727777.1 Gene:betaNACtes2 / 32386 FlyBaseID:FBgn0030563 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_689478.1 Gene:BTF3L4 / 91408 HGNCID:30547 Length:158 Species:Homo sapiens


Alignment Length:166 Identity:42/166 - (25%)
Similarity:78/166 - (46%) Gaps:23/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFKTLKKMEEAVRIGGNGSMRRKHKKIPSLNADDEKRVRAALAMLPLKNLGEIQEMTIKFSDSS 65
            |:.:.|.|::..|||||.|:.|||.|.:......|:|:::::|..|.:.|:..|:|:.:...|.:
Human     1 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGT 65

  Fly    66 EVVVIMPRIQKTNPSYFFVMSGHFVRKSLTAGPSKAPKAPKPHKPKSFSDKKAESGESIKMVAKK 130
            .:....|::|.:..:..|.::||...|.:|           ...|...|...|:|..|::.:|::
Human    66 VIHFNNPKVQASLSANTFAITGHAEAKPIT-----------EMLPGILSQLGADSLTSLRKLAEQ 119

  Fly   131 -PKNKEEAAMAGGDSEPKLSNGKSILISSEDGSDPD 165
             |:...::      ..||..:     |..||...||
Human   120 FPRQVLDS------KAPKPED-----IDEEDDDVPD 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaNACtes2NP_727777.1 NAC 38..91 CDD:280093 11/52 (21%)
BTF3L4NP_689478.1 NAC_BTF3 4..120 CDD:409234 33/126 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..158 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.