DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaNACtes2 and BTT1

DIOPT Version :9

Sequence 1:NP_727777.1 Gene:betaNACtes2 / 32386 FlyBaseID:FBgn0030563 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_010538.1 Gene:BTT1 / 851839 SGDID:S000002660 Length:149 Species:Saccharomyces cerevisiae


Alignment Length:83 Identity:24/83 - (28%)
Similarity:37/83 - (44%) Gaps:16/83 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LKKMEEAVRIGGNGSMRRKHKKIPSL---NADDEKRVRAALAML---PLKNLGEI-----QEMTI 59
            |.|:..|.::||.   |||..|..:|   |..|..:::|.|..|   .::|:.|.     ....:
Yeast    11 LHKLSAANKVGGT---RRKINKKGNLYNNNDKDNTKLQAELHKLHPMTIENVAEANFFKKNGKVL 72

  Fly    60 KFSDSSEVVVIMPRIQKT 77
            .|  :|.||.|.|:...|
Yeast    73 HF--NSAVVQIAPQCNLT 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaNACtes2NP_727777.1 NAC 38..91 CDD:280093 12/48 (25%)
BTT1NP_010538.1 NAC_BTF3 9..125 CDD:409234 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.