DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaNACtes2 and AT1G73230

DIOPT Version :9

Sequence 1:NP_727777.1 Gene:betaNACtes2 / 32386 FlyBaseID:FBgn0030563 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_177466.1 Gene:AT1G73230 / 843657 AraportID:AT1G73230 Length:165 Species:Arabidopsis thaliana


Alignment Length:169 Identity:43/169 - (25%)
Similarity:77/169 - (45%) Gaps:29/169 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFKTLKKMEEAVRIGGNGSMRRKHKKIPSLNADDEKRVRAALAMLPLKNLGEIQEMTIKFSDSS 65
            |:.:.|.||...||.||.|::|||.|.:......|:||:::.|..:.:.::..|:|:.| |.|..
plant     1 MNREKLMKMANTVRTGGKGTVRRKKKAVHKTTTTDDKRLQSTLKRVGVNSIPAIEEVNI-FKDDV 64

  Fly    66 EVVVIMPRIQKTNPSYFFVMSGHFVRKSLTAGPSKAPKAPKPHK--PKSFSDKKAESGESIKMVA 128
            .:..|.|::|.:..:..:|:||             .|:..|...  |:..|....::.:::|.:|
plant    65 VIQFINPKVQASIAANTWVVSG-------------TPQTKKLQDILPQIISQLGPDNLDNLKKLA 116

  Fly   129 KKPKNKEEAAMAGGDSEPKLSNGKSILISSEDGSD--PD 165
            ::   .::.|...||        ....|..||..|  ||
plant   117 EQ---FQKQAPGAGD--------VPATIQEEDDDDDVPD 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaNACtes2NP_727777.1 NAC 38..91 CDD:280093 13/52 (25%)
AT1G73230NP_177466.1 NAC_BTF3 4..119 CDD:409234 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.