DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaNACtes2 and BTF3

DIOPT Version :9

Sequence 1:NP_727777.1 Gene:betaNACtes2 / 32386 FlyBaseID:FBgn0030563 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_173230.1 Gene:BTF3 / 838367 AraportID:AT1G17880 Length:165 Species:Arabidopsis thaliana


Alignment Length:184 Identity:47/184 - (25%)
Similarity:85/184 - (46%) Gaps:37/184 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFKTLKKMEEAVRIGGNGSMRRKHKKIPSLNADDEKRVRAALAMLPLKNLGEIQEMTIKFSDSS 65
            |:.:.|.||...||.||.|::|||.|.:...|..|:||:::.|..:.:.::..|:|:.| |.|..
plant     1 MNREKLMKMANTVRTGGKGTVRRKKKAVHKTNTTDDKRLQSTLKRIGVNSIPAIEEVNI-FKDDV 64

  Fly    66 EVVVIMPRIQKTNPSYFFVMSGHFVRKSLTAGPSKAPKAPKPHK--PKSFSDKKAESGESIKMVA 128
            .:..|.|::|.:..:..:|:||             :|:..|...  |:..|....::.:::|.:|
plant    65 VIQFINPKVQASIAANTWVVSG-------------SPQTKKLQDILPQIISQLGPDNMDNLKKLA 116

  Fly   129 KKPKNKEEAAMAGGDSEPKLSNGKSILISSEDGSD-PD----------NEKVPS 171
            ::.:.:     |.|:     .|..|..|..||..| |:          .||.|:
plant   117 EQFQKQ-----ASGE-----GNAASATIQEEDDDDVPELVGETFETAAEEKAPA 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaNACtes2NP_727777.1 NAC 38..91 CDD:280093 13/52 (25%)
BTF3NP_173230.1 NAC 38..90 CDD:376630 14/65 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.