DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaNACtes2 and BTF3

DIOPT Version :9

Sequence 1:NP_727777.1 Gene:betaNACtes2 / 32386 FlyBaseID:FBgn0030563 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001032726.1 Gene:BTF3 / 689 HGNCID:1125 Length:206 Species:Homo sapiens


Alignment Length:171 Identity:44/171 - (25%)
Similarity:82/171 - (47%) Gaps:30/171 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFKTLKKMEEAVRIGGNGSMRRKHKKIPSLNADDEKRVRAALAMLPLKNLGEIQEMTIKFSDSS 65
            |:.:.|.|::..|||||.|:.|||.|.:......|:|:::.:|..|.:.|:..|:|:.:..:..:
Human    50 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGT 114

  Fly    66 EVVVIMPRIQKTNPSYFFVMSGHFVRKSLTAGPSKAPKAPKPHKPKSFSDKKAESGESIKMVAKK 130
            .:....|::|.:..:..|.::||...|.||           ...|...:...|:|..|::.:|  
Human   115 VIHFNNPKVQASLAANTFTITGHAETKQLT-----------EMLPSILNQLGADSLTSLRRLA-- 166

  Fly   131 PKNKEEAAMAGGDSEPKLS-NGKSILISSEDGSDPDNEKVP 170
                        ::.||.| :||:.|.:.||    |:::||
Human   167 ------------EALPKQSVDGKAPLATGED----DDDEVP 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaNACtes2NP_727777.1 NAC 38..91 CDD:280093 10/52 (19%)
BTF3NP_001032726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
NAC 87..140 CDD:376630 10/52 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..206 11/26 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.