DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaNACtes2 and btf3l4

DIOPT Version :9

Sequence 1:NP_727777.1 Gene:betaNACtes2 / 32386 FlyBaseID:FBgn0030563 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001011243.1 Gene:btf3l4 / 496686 XenbaseID:XB-GENE-948236 Length:158 Species:Xenopus tropicalis


Alignment Length:160 Identity:41/160 - (25%)
Similarity:75/160 - (46%) Gaps:27/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFKTLKKMEEAVRIGGNGSMRRKHKKIPSLNADDEKRVRAALAMLPLKNLGEIQEMTIKFSDSS 65
            |:.:.|.|::..|||||.|:.|||.|.:......|:|:::::|..|.:.|:..|:|:.:...|.:
 Frog     1 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGT 65

  Fly    66 EVVVIMPRIQKTNPSYFFVMSGHFVRKSLTAGPSKAPKAPKPHKPKSFSDKKAESGESIKMVAK- 129
            .:....|::|.:..:..|.::||...|.:|           ...|...|...|:|..|::.:|: 
 Frog    66 VIHFNNPKVQASLSANTFAITGHAEVKQIT-----------EMLPGILSQLGADSLTSLRKLAEQ 119

  Fly   130 -----------KPKNKEEAAMAGGDSEPKL 148
                       ||::.||.    .|..|:|
 Frog   120 FPRQVLDSKASKPEDIEEE----DDDVPEL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaNACtes2NP_727777.1 NAC 38..91 CDD:280093 11/52 (21%)
btf3l4NP_001011243.1 NAC 38..91 CDD:376630 11/52 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..158 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.