DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaNACtes2 and Btf3l4

DIOPT Version :9

Sequence 1:NP_727777.1 Gene:betaNACtes2 / 32386 FlyBaseID:FBgn0030563 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_006238641.1 Gene:Btf3l4 / 366434 RGDID:1311774 Length:158 Species:Rattus norvegicus


Alignment Length:166 Identity:42/166 - (25%)
Similarity:78/166 - (46%) Gaps:23/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFKTLKKMEEAVRIGGNGSMRRKHKKIPSLNADDEKRVRAALAMLPLKNLGEIQEMTIKFSDSS 65
            |:.:.|.|::..|||||.|:.|||.|.:......|:|:::::|..|.:.|:..|:|:.:...|.:
  Rat     1 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGT 65

  Fly    66 EVVVIMPRIQKTNPSYFFVMSGHFVRKSLTAGPSKAPKAPKPHKPKSFSDKKAESGESIKMVAKK 130
            .:....|::|.:..:..|.::||...|.:|           ...|...|...|:|..|::.:|::
  Rat    66 VIHFNNPKVQASLSANTFAITGHAEAKPIT-----------EMLPGILSQLGADSLTSLRKLAEQ 119

  Fly   131 -PKNKEEAAMAGGDSEPKLSNGKSILISSEDGSDPD 165
             |:...::      ..||..:     |..||...||
  Rat   120 FPRQVLDS------KAPKPED-----IDEEDDDVPD 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaNACtes2NP_727777.1 NAC 38..91 CDD:280093 11/52 (21%)
Btf3l4XP_006238641.1 NAC_BTF3 4..120 CDD:409234 33/126 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.