DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaNACtes2 and CG11835

DIOPT Version :9

Sequence 1:NP_727777.1 Gene:betaNACtes2 / 32386 FlyBaseID:FBgn0030563 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001259835.1 Gene:CG11835 / 33232 FlyBaseID:FBgn0031264 Length:795 Species:Drosophila melanogaster


Alignment Length:235 Identity:50/235 - (21%)
Similarity:92/235 - (39%) Gaps:66/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFKTLKKMEEAVRIGGNGSMRRKHKKIPSLNADDEKRVRAALAMLPLKNLGEIQEMTIKFSDSS 65
            |:.:.||:::..|||||.|:.|||.|.:....|.|:|:::::|..|.:..:..|:|:.|...|.:
  Fly     1 MNVEKLKRLQAQVRIGGKGTPRRKKKVMHQTAATDDKKLQSSLKKLSVSTIPGIEEVNIIKDDLT 65

  Fly    66 EVVVIMPRIQKTNPSYFFVMSGH-FVRKSLTAGPSKAPK-------------------------- 103
            .:....|:.|.:..:..|.::|| ..||.:...|...|:                          
  Fly    66 VIHFNNPKAQASLSANTFAVTGHGETRKVVEMLPDILPQLGQETVVQLRMYANAMNSQKGAPGSG 130

  Fly   104 -APKP---------------------------HKPKSFSDKKAESGESIKMVAKKPKNKEEAAMA 140
             .|.|                           |:||..::.||:.    |...:..|.::::|..
  Fly   131 DGPLPAEEDDDVPLLVGDFDEVAKVEATKQPVHEPKESAEIKAKD----KQQQQPKKEQKQSAKV 191

  Fly   141 GGDSEP------KLSNGKSILISSEDGSDPDNEKVPSDES 174
            ...:.|      |..|.|....:::.| ||...|..:::|
  Fly   192 PETTNPSENPKEKQENKKGQAKNNKKG-DPQTNKDKTNKS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaNACtes2NP_727777.1 NAC 38..91 CDD:280093 11/53 (21%)
CG11835NP_001259835.1 NAC 38..91 CDD:280093 11/52 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2240
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.